Protein
MCA_03952_1
Length
164 amino acids
Gene name: ARC19
Description: Actin-related protein 2/3 complex subunit 4
Browser: contigC:1603489-1604069+
RNA-seq: read pairs 7768, FPKM 581.7, percentile rank 94.9% (100% = highest expression)
Protein function
| Annotation: | ARC19 | Actin-related protein 2/3 complex subunit 4 | |
|---|---|---|---|
| KEGG: | K05755 | ARPC4 | actin related protein 2/3 complex, subunit 4 |
| EGGNOG: | 0PFJR | ARC19 | Arp2 3 complex 20 kDa subunit |
| SGD closest match: | S000001496 | ARC19 | Actin-related protein 2/3 complex subunit 4 |
| CGD closest match: | CAL0000200234 | ARC19 | Actin-related protein 2/3 complex subunit 4 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00072_1 | 86.83% | 167 | 2e-102 | MIA_00072_1 |
| A0A0J9X998_GEOCN | 92.90% | 155 | 2e-101 | Actin-related protein 2/3 complex subunit 4 OS=Geotrichum candidum GN=BN980_GECA05s06236g PE=3 SV=1 |
| A0A060TIQ7_BLAAD | 90.20% | 153 | 2e-97 | Actin-related protein 2/3 complex subunit 4 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39908g PE=3 SV=1 |
| UniRef50_A0A0C4ECF7 | 81.94% | 155 | 8e-89 | Actin-related protein 2/3 complex subunit 4 n=144 Tax=Opisthokonta TaxID=33154 RepID=A0A0C4ECF7_MAGP6 |
| A0A1E3PH08_9ASCO | 83.87% | 155 | 3e-91 | Actin-related protein 2/3 complex subunit 4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47308 PE=3 SV=1 |
| Q6CAH1_YARLI | 80.65% | 155 | 5e-89 | Actin-related protein 2/3 complex subunit 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D02805g PE=3 SV=2 |
| A0A1E4TJK4_9ASCO | 77.42% | 155 | 7e-85 | Actin-related protein 2/3 complex subunit 4 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_512 PE=3 SV=1 |
| ARPC4_YEAST | 72.44% | 156 | 2e-74 | Actin-related protein 2/3 complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC19 PE=1 SV=2 |
| A0A1D8PRU4_CANAL | 75.47% | 159 | 1e-73 | Actin-related protein 2/3 complex subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARC19 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0596
Protein family membership
- Arp2/3 complex subunit 2/4 (IPR034666)
- Actin-related protein 2/3 complex subunit 4 (IPR008384)
Domains and repeats
None predicted.
Detailed signature matches
-
-
-
SSF69645 (Arp2/3 co...)
-
-
-
PIRSF039100 (ARPC4)
-
PF05856 (ARPC4)
-
no IPR
Unintegrated signatures
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
Protein sequence
>MCA_03952_1 MVSSQKYMFSLTAALCLENFASQTVERHNTPEVEIGTTPEALLNPLTIARNENEKVLIEPSINSVRLSIKIKQADEIENI LVRQFARFLTGRAEAFFILRRKPIADYDISFLITNYHTEQMLKHKLVDFIIEFMEEVDKEISEMKLFLNARARFVAEAYL TPFD
GO term prediction
Biological Process
GO:0030041 actin filament polymerization
GO:0030833 regulation of actin filament polymerization
GO:0034314 Arp2/3 complex-mediated actin nucleation
Molecular Function
None predicted.
Cellular Component
GO:0005885 Arp2/3 protein complex
GO:0015629 actin cytoskeleton