Protein
MCA_03802_2
Length
243 amino acids
Gene name: RPL7B
Description: 60S ribosomal protein L7
Browser: contigC:1132951-1134234+
RNA-seq: read pairs 65835, FPKM 3333.9, percentile rank 98.7% (100% = highest expression)
Protein function
| Annotation: | RPL7B | 60S ribosomal protein L7 | |
|---|---|---|---|
| KEGG: | K02937 | RP-L7e | large subunit ribosomal protein L7e |
| EGGNOG: | 0PGRR | RPL7 | 60S ribosomal protein L7 |
| SGD closest match: | S000006119 | RPL7B | 60S ribosomal protein L7-B |
| CGD closest match: | CAL0000182421 | orf19.2478.1 | Ribosomal 60S subunit protein L7A |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03668_1 | 82.72% | 243 | 2e-125 | MIA_03668_1 |
| A0A0J9XGN6_GEOCN | 69.96% | 243 | 2e-106 | Similar to Saccharomyces cerevisiae YPL198W RPL7B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA15s01979g PE=4 SV=1 |
| A0A161HMA2_9ASCO | 67.08% | 243 | 3e-103 | Ribosomal 60S subunit protein L7B OS=Sugiyamaella lignohabitans GN=RPL7B PE=4 SV=1 |
| RL7B_YEAST | 68.44% | 244 | 6e-102 | 60S ribosomal protein L7-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL7B PE=1 SV=3 |
| UniRef50_P05737 | 68.03% | 244 | 3e-98 | 60S ribosomal protein L7-A n=300 Tax=Eukaryota TaxID=2759 RepID=RL7A_YEAST |
| A0A060T863_BLAAD | 76.09% | 184 | 6e-101 | ARAD1C33990p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C33990g PE=4 SV=1 |
| RL7_YARLI | 63.79% | 243 | 1e-99 | 60S ribosomal protein L7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL7 PE=3 SV=1 |
| A0A1E3PK23_9ASCO | 64.73% | 241 | 1e-97 | 60S large subunit ribosomal protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82594 PE=4 SV=1 |
| A0A1E4TM20_9ASCO | 63.95% | 233 | 7e-96 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1370 PE=4 SV=1 |
| A0A1D8PDL6_CANAL | 63.90% | 241 | 4e-93 | Ribosomal 60S subunit protein L7A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2478.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5811
Protein family membership
- Ribosomal protein L7, eukaryotic (IPR005998)
Domains and repeats
-
Domain
1
50
100
150
200
243
Detailed signature matches
Residue annotation
-
23S rRNA binding s...
-
5S rRNA binding si...
Protein sequence
>MCA_03802_2 MSAASIITPESLQKKVKREGTLAIQQAVKLAKDEKALEKKNKVIYERAAAYEKEYEAAARDLIEKKRAARAEGSFYVPAQ PKLIFVVRIKGINKIAPKPRKVLQLLRLLQINNGTFIRVTKATEELLRLVEPYVAYGYPSLSTVRKLIYKRGHGKINNQR LRLDNNVIEAALGQYGIICIEDLIHEIYTVGPNFKQANNFLLPFHLSNPSGGWGVPRKFKHFIEGGSLGNREENINALVQ AMN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.
no IPR