Protein
MCA_03660_1
Length
148 amino acids
Gene name: TVP18
Description: Golgi apparatus membrane protein TVP18
Browser: contigC:712155-713773-
RNA-seq: read pairs 311, FPKM 25.8, percentile rank 48.4% (100% = highest expression)
Protein function
| Annotation: | TVP18 | Golgi apparatus membrane protein TVP18 | |
|---|---|---|---|
| EGGNOG: | 0PKCP | TVP18 | Golgi membrane protein involved in vesicular trafficking (By similarity) |
| SGD closest match: | S000004675 | TVP18 | Golgi apparatus membrane protein TVP18 |
| CGD closest match: | CAL0000196216 | TVP18 | Golgi apparatus membrane protein TVP18 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03463_1 | 85.81% | 148 | 3e-80 | MIA_03463_1 |
| A0A0J9XIK8_GEOCN | 72.97% | 148 | 3e-67 | Similar to Saccharomyces cerevisiae YMR071C TVP18 Integral membrane protein localized to late Golgi vesicles along with the v-SNARE Tlg2 OS=Geotrichum candidum GN=BN980_GECA16s02859g PE=4 SV=1 |
| TVP18_YARLI | 74.32% | 148 | 1e-64 | Golgi apparatus membrane protein TVP18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TVP18 PE=3 SV=1 |
| A0A1E3PG76_9ASCO | 71.62% | 148 | 2e-62 | Golgi apparatus membrane protein TVP18 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52865 PE=4 SV=1 |
| A0A060T6Q5_BLAAD | 70.75% | 147 | 3e-62 | ARAD1B13992p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B13992g PE=4 SV=1 |
| TVP18_CANAL | 64.93% | 134 | 3e-52 | Golgi apparatus membrane protein TVP18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TVP18 PE=3 SV=1 |
| UniRef50_A3LPS1 | 64.66% | 133 | 4e-44 | Golgi apparatus membrane protein TVP18 n=29 Tax=Saccharomycetales TaxID=4892 RepID=TVP18_PICST |
| A0A1E4TAY9_9ASCO | 57.24% | 145 | 1e-46 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32347 PE=4 SV=1 |
| TVP18_YEAST | 58.65% | 133 | 6e-40 | Golgi apparatus membrane protein TVP18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TVP18 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0484
Protein family membership
- TVP18/Calcium channel flower (IPR019365)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_03660_1 MTFSDELKTRNFSIYGQWIGIISIILCIALGIANIFHVNWVIAFSIICIVQGLVVTFVEIPFLLRICPLTDRFTNFIRKF NQNLPRAGFYLAMAAIQYVSCVAMVTSLLAVAIIFTLASICYGLAALKKQEFMTSSTLGGAGIARQIL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane