Protein
MCA_02905_1
Length
117 amino acids
Gene name: ATP14
Description: ATP synthase subunit H, mitochondrial
Browser: contigB:2704040-2704993+
RNA-seq: read pairs 24632, FPKM 2579.3, percentile rank 98.1% (100% = highest expression)
Protein function
| Annotation: | ATP14 | ATP synthase subunit H, mitochondrial | |
|---|---|---|---|
| KEGG: | K02141 | ATPeFH | F-type H+-transporting ATPase subunit h |
| EGGNOG: | 0PST4 | ATP14 | subunit h EC 3.6.3.14 |
| SGD closest match: | S000004286 | ATP14 | ATP synthase subunit H, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03349_1 | 76.07% | 117 | 2e-33 | MIA_03349_1 |
| A0A0J9X2D6_GEOCN | 57.26% | 117 | 4e-27 | Similar to Saccharomyces cerevisiae YLR295C ATP14 Subunit h of the F0 sector of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA01s00450g PE=4 SV=1 |
| UniRef50_A0A1E3QEQ6 | 54.55% | 88 | 4e-13 | Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3QEQ6_LIPST |
| Q6C2V6_YARLI | 46.34% | 82 | 3e-11 | YALI0F04774p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04774g PE=4 SV=1 |
| A0A060T3U0_BLAAD | 47.87% | 94 | 5e-11 | ARAD1C36432p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C36432g PE=4 SV=1 |
| ATP14_YEAST | 46.43% | 56 | 4e-09 | ATP synthase subunit H, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP14 PE=1 SV=1 |
| A0A1E3PS33_9ASCO | 48.57% | 70 | 3e-08 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48895 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9917
Predicted cleavage: 30
Protein family membership
- ATP synthase, F0 complex, subunit H (IPR019711)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF10775 (ATP_sub_h)
-
Protein sequence
>MCA_02905_1 MIAPVIRLSARRLPTMVSRRAISVSAVRSNLIQDLYIKEIKGYKAPPLTLKDAEGSVKPWTPPAAPSAPSVEGDVAADLA AYESSSVEVESQASTSSTPEAAVEDWFVIEPANDLHH
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
None predicted.
Cellular Component
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)