Protein
MCA_01916_1
Length
564 amino acids
Gene name: PRI2
Description: DNA primase large subunit
Browser: contigA:5867367-5869062+
RNA-seq: read pairs 78, FPKM 1.7, percentile rank 11.0% (100% = highest expression)
Protein function
| Annotation: | PRI2 | DNA primase large subunit | |
|---|---|---|---|
| KEGG: | K02685 | PRI2 | DNA primase large subunit [EC:2.7.7.-] |
| EGGNOG: | 0PIE0 | FG01839.1 | DNA primase large subunit |
| SGD closest match: | S000001528 | PRI2 | DNA primase large subunit |
| CGD closest match: | CAL0000183113 | PRI2 | DNA primase large subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02258_1 | 56.51% | 545 | 0.0 | MIA_02258_1 |
| A0A0J9XAW0_GEOCN | 53.01% | 549 | 0.0 | DNA primase large subunit OS=Geotrichum candidum GN=BN980_GECA07s04212g PE=3 SV=1 |
| UniRef50_A0A0J9XAW0 | 53.01% | 549 | 0.0 | DNA primase large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XAW0_GEOCN |
| A0A1E3PDW7_9ASCO | 50.26% | 382 | 1e-118 | DNA primase large subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_71858 PE=3 SV=1 |
| A0A167FE35_9ASCO | 48.83% | 385 | 4e-117 | DNA primase large subunit OS=Sugiyamaella lignohabitans GN=PRI2 PE=3 SV=1 |
| A0A1E4TLE3_9ASCO | 35.86% | 527 | 5e-109 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_17020 PE=4 SV=1 |
| PRI2_YEAST | 45.48% | 409 | 2e-103 | DNA primase large subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRI2 PE=1 SV=1 |
| A0A1D8PML0_CANAL | 42.12% | 406 | 2e-101 | DNA primase large subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRI2 PE=3 SV=1 |
| A0A060T4L4_BLAAD | 42.24% | 393 | 2e-95 | ARAD1B00506p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B00506g PE=4 SV=1 |
| Q6C2W5_YARLI | 40.46% | 393 | 7e-92 | DNA primase large subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04576g PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5285
Protein family membership
- DNA primase large subunit, eukaryotic/archaeal (IPR007238)
- DNA primase, large subunit, eukaryotic (IPR016558)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04104 (DNA_primas...)
-
-
-
PIRSF009449 (DNA_pr...)
-
cd07322 (PriL_PriS_...)
-
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Residue annotation
-
PriL_PriS interfac...
Protein sequence
>MCA_01916_1 MFKQNFKRQRAQERRNASIEDNNPLNESALHYPFRLNFYNYPPLLEITIEQFEQWAIDRMRVLGEIEARLARNMNSKELE LSMKPILDELLPLGRSNNTDKLFPTNNNNNNPKSNNTTQDEIIKEFNNNEDDNNDEDIGQVDIKNGKQAKFQFDPENEQH RRLKDHYSHFILRLAFCRSQELRRKFVHAETTLFKIRYNTDDIKERNAFVKTCNLPWEPVSMQEKRALSTKLVYSGYDDD GSTTLLSNPENNNPEDIEYFKINFEKVPFLVEDRRVLLHKGMAYVPITYQRTILTQEFASRLDRALIQTVRALPRLDEDS RLVPLLNHLALGFEAVSTYDPTTNSLSNNSGGEEMTAEMVDQLATTSDFPLCMQTMHQGLLQNKHLRYTGRIQYGLFLKW IGLSVDEALKFWKSHFGAVSEDKFAKEYRYNIRHQYGLEGSRINYKPQSCADIIKAPPPARGEYHGCPYRTLSTDALSQA LRKMGISDPKQLTTIQDSVAKKQFHIACTKVFEITHPEEGDGDGKQTNETITYPNQYFEKSWRYRKAQQQKMGSDPSSIP TEVA
GO term prediction
Biological Process
GO:0006269 DNA replication, synthesis of RNA primer
Molecular Function
GO:0003896 DNA primase activity
GO:0016779 nucleotidyltransferase activity
Cellular Component
None predicted.