Protein
MCA_01891_1
Length
346 amino acids
Browser: contigA:5788588-5789870-
RNA-seq: read pairs 358, FPKM 12.7, percentile rank 30.5% (100% = highest expression)
Protein function
| KEGG: | K11271 | DSCC1 | sister chromatid cohesion protein DCC1 |
|---|---|---|---|
| EGGNOG: | 0PI22 | PGUG_04794 | Sister chromatid cohesion protein |
| SGD closest match: | S000000521 | DCC1 | Sister chromatid cohesion protein DCC1 |
| CGD closest match: | CAL0000186528 | DCC1 | Dcc1p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00556_1 | 40.55% | 365 | 2e-77 | MIA_00556_1 |
| A0A1E3PNW7_9ASCO | 33.24% | 346 | 2e-46 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49571 PE=4 SV=1 |
| UniRef50_A0A1E3PNW7 | 33.24% | 346 | 5e-43 | Uncharacterized protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PNW7_9ASCO |
| A0A060TCA2_BLAAD | 29.19% | 346 | 1e-42 | ARAD1D34694p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D34694g PE=4 SV=1 |
| Q6CBF9_YARLI | 30.99% | 313 | 4e-38 | YALI0C19217p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C19217g PE=4 SV=1 |
| A0A0J9X313_GEOCN | 33.42% | 380 | 1e-37 | Similar to Saccharomyces cerevisiae YCL016C DCC1 Subunit of a complex with Ctf8p and Ctf18p that shares some components with Replication Factor C OS=Geotrichum candidum GN=BN980_GECA02s01297g PE=4 SV=1 |
| DCC1_YEAST | 25.89% | 367 | 3e-32 | Sister chromatid cohesion protein DCC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCC1 PE=1 SV=2 |
| A0A1D8PQK7_CANAL | 25.22% | 341 | 3e-25 | Dcc1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCC1 PE=4 SV=1 |
| A0A167CNV2_9ASCO | 32.98% | 188 | 2e-16 | Dcc1p OS=Sugiyamaella lignohabitans GN=DCC1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0880
Protein family membership
- Sister chromatid cohesion protein Dcc1 (IPR019128)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_01891_1 MALYSNFGKRKYKLLELTPELLQCINDSKELQLKSETETSDLVLCTNNKTFRVREAHHSNSLFVSSSFSSDVDLPDFNSI SLLDNVPAIWETEPVDIKSLKMPYVPRYFGNNFPPSPQISLDELKANFPCSNAQFEEFWRNEGGLVLEDCACVLDSKILK ETLDNILVTAQANNFPINALDESDIQTVLISKRQEYNEPLLLITTTLKKFSTSLTGPYDLDMDAVIKWYGLNILRKQKTA LSTQEFLQLWKNDIPIIVDNELKLDSLSEHFVYLERNMMRYIDSNQLPKNPKDRILLLLSIKSAWELDELTPFIKEIVPN NVKIANFVMKFARKRQVGSKTIISSR
GO term prediction
Biological Process
GO:0007064 mitotic sister chromatid cohesion
Molecular Function
None predicted.
Cellular Component
GO:0031390 Ctf18 RFC-like complex