Protein
MCA_01885_1
Length
154 amino acids
Gene name: TIM17
Description: Mitochondrial import inner membrane translocase subunit TIM17
Browser: contigA:5773967-5774610+
RNA-seq: read pairs 1374, FPKM 109.5, percentile rank 80.3% (100% = highest expression)
Protein function
| Annotation: | TIM17 | Mitochondrial import inner membrane translocase subunit TIM17 | |
|---|---|---|---|
| KEGG: | K17795 | TIM17 | mitochondrial import inner membrane translocase subunit TIM17 |
| EGGNOG: | 0PJTI | TIM17 | Mitochondrial import inner membrane translocase subunit |
| SGD closest match: | S000003679 | TIM17 | Mitochondrial import inner membrane translocase subunit TIM17 |
| CGD closest match: | CAL0000179179 | TIM17 | Mitochondrial import inner membrane translocase subunit TIM17 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A060T457_BLAAD | 88.08% | 151 | 8e-98 | Mitochondrial import inner membrane translocase subunit TIM17 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C41646g PE=3 SV=1 |
| MIA_04313_1 | 86.36% | 154 | 2e-93 | MIA_04313_1 |
| A0A0J9XK16_GEOCN | 84.21% | 152 | 9e-94 | Mitochondrial import inner membrane translocase subunit TIM17 OS=Geotrichum candidum GN=BN980_GECA27s00835g PE=3 SV=1 |
| A0A161HFI3_9ASCO | 83.78% | 148 | 6e-92 | Mitochondrial import inner membrane translocase subunit TIM17 OS=Sugiyamaella lignohabitans GN=TIM17 PE=3 SV=1 |
| A0A1E3PLJ6_9ASCO | 81.05% | 153 | 3e-90 | Mitochondrial import inner membrane translocase subunit TIM17 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51425 PE=3 SV=1 |
| A0A1E4TIG0_9ASCO | 79.73% | 148 | 2e-86 | Mitochondrial import inner membrane translocase subunit TIM17 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_84 PE=3 SV=1 |
| UniRef50_Q75BM3 | 76.51% | 149 | 2e-79 | Mitochondrial import inner membrane translocase subunit TIM17 n=6 Tax=Opisthokonta TaxID=33154 RepID=Q75BM3_ASHGO |
| TIM17_YEAST | 74.50% | 149 | 1e-81 | Mitochondrial import inner membrane translocase subunit TIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM17 PE=1 SV=1 |
| Q59LI2_CANAL | 73.20% | 153 | 1e-78 | Mitochondrial import inner membrane translocase subunit TIM17 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM17 PE=3 SV=1 |
| B5FVH9_YARLI | 74.44% | 133 | 7e-71 | YALI0E15136p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E15136g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0447
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF02466 (Tim17)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_01885_1 MADHSRDPCPIVILSDFGGAFSMGVVGGAIWHGIKGFRNSPIGERRAGAISAIKLRAPTVGGNFGVWGGIFSTFDCLVKS VRRTEDPFNAIIAGFFTGGALAIRGGWKATRNGAIACACVLAVFEGVGLGMQRMMAYQNKPVAPQIPDAPLAAA
GO term prediction
Biological Process
GO:0006886 intracellular protein transport
Molecular Function
GO:0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity
Cellular Component
GO:0005744 mitochondrial inner membrane presequence translocase complex