Protein
MCA_01735_1
Length
154 amino acids
Gene name: YPD1
Description: Phosphorelay intermediate protein YPD1; putative protein kinase; in S. cerevisiae involed in osmoregulation
Browser: contigA:5324086-5324551-
RNA-seq: read pairs 960, FPKM 76.5, percentile rank 74.5% (100% = highest expression)
Protein function
| Annotation: | YPD1 | Phosphorelay intermediate protein YPD1; putative protein kinase; in S. cerevisiae involed in osmoregulation | |
|---|---|---|---|
| KEGG: | K11232 | YPD1 | osomolarity two-component system, phosphorelay intermediate protein YPD1 |
| EGGNOG: | 0PQMZ | FG04363.1 | Phosphotransmitter protein Ypd1 |
| SGD closest match: | S000002394 | YPD1 | Phosphorelay intermediate protein YPD1 |
| CGD closest match: | CAL0000174022 | YPD1 | Phosphorelay intermediate protein YPD1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| UniRef50_A0A1L9X6M8 | 58.82% | 119 | 8e-38 | Uncharacterized protein n=3 Tax=Aspergillaceae TaxID=1131492 RepID=A0A1L9X6M8_ASPAC |
| A0A0J9X566_GEOCN | 55.65% | 124 | 6e-40 | Similar to Saccharomyces cerevisiae YDL235C YPD1 Phosphorelay intermediate protein, phosphorylated by the plasma membrane sensor Sln1p in response to osmotic stress OS=Geotrichum candidum GN=BN980_GECA02s08139g PE=4 SV=1 |
| A0A1E3PST0_9ASCO | 54.78% | 115 | 4e-39 | Histidine-phosphotransfer domain, HPT domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_20799 PE=4 SV=1 |
| MIA_00341_1 | 49.61% | 129 | 5e-38 | MIA_00341_1 |
| A0A060TFA7_BLAAD | 53.72% | 121 | 2e-35 | ARAD1D14080p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D14080g PE=4 SV=1 |
| A0A167CZC7_9ASCO | 51.64% | 122 | 2e-34 | Ypd1p OS=Sugiyamaella lignohabitans GN=YPD1 PE=4 SV=1 |
| Q6CD05_YARLI | 50.41% | 121 | 4e-29 | YALI0C04928p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C04928g PE=4 SV=1 |
| A0A1E4TE05_9ASCO | 46.72% | 122 | 7e-26 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1714 PE=4 SV=1 |
| YPD1_CANAL | 46.91% | 81 | 2e-17 | Phosphorelay intermediate protein YPD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YPD1 PE=3 SV=1 |
| YPD1_YEAST | 50.00% | 60 | 4e-14 | Phosphorelay intermediate protein YPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPD1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0862
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
20
40
60
80
100
120
140
154
Detailed signature matches
no IPR
Unintegrated signatures
Residue annotation
-
active site cd00088
-
putative binding s...
Protein sequence
>MCA_01735_1 MTADNDNGVSEYIDKVTFSQIQEMDDDGDHEFSCSILFDFFDQAETSFGDMQDALEKKDLANLSSLGHFLKGSAATLGLI KVKDHCEKIQHLGEMKDETGMREVNDAQLCLDKIAEILKALRVDYDESVQKLKILGYDRETQSFTEPPNSNNTD
GO term prediction
Biological Process
GO:0000160 phosphorelay signal transduction system
Molecular Function
GO:0004871 signal transducer activity
Cellular Component
None predicted.