Protein
MCA_01621_1
Length
167 amino acids
Gene name: RSM18
Description: 37S ribosomal protein RSM18, mitochondrial
Browser: contigA:4997996-4998553-
RNA-seq: read pairs 3317, FPKM 244.0, percentile rank 90.2% (100% = highest expression)
Protein function
| Annotation: | RSM18 | 37S ribosomal protein RSM18, mitochondrial | |
|---|---|---|---|
| KEGG: | K02963 | RP-S18 | small subunit ribosomal protein S18 |
| EGGNOG: | 0PQXB | FG10218.1 | mitochondrial 37S ribosomal protein RSM18 |
| SGD closest match: | S000000852 | RSM18 | 37S ribosomal protein RSM18, mitochondrial |
| CGD closest match: | CAL0000192931 | orf19.5201 | Mitochondrial 37S ribosomal protein RSM18 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A060TGE7_BLAAD | 41.67% | 108 | 8e-21 | ARAD1D22990p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D22990g PE=4 SV=1 |
| UniRef50_A0A060TGE7 | 41.67% | 108 | 2e-17 | ARAD1D22990p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060TGE7_BLAAD |
| A0A0J9X5D6_GEOCN | 39.82% | 113 | 3e-17 | Similar to Saccharomyces cerevisiae YER050C RSM18 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA03s04432g PE=4 SV=1 |
| MIA_02347_1 | 45.45% | 88 | 2e-16 | MIA_02347_1 |
| RSM18_YEAST | 33.33% | 90 | 4e-12 | 37S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM18 PE=1 SV=2 |
| A0A167D7K3_9ASCO | 40.85% | 71 | 1e-11 | Mitochondrial 37S ribosomal protein RSM18 OS=Sugiyamaella lignohabitans GN=RSM18 PE=4 SV=1 |
| Q59KY7_CANAL | 32.53% | 83 | 3e-09 | Mitochondrial 37S ribosomal protein RSM18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5201 PE=4 SV=1 |
| A0A1E3PNF8_9ASCO | 32.48% | 117 | 4e-06 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81596 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9886
Predicted cleavage: 27
Protein family membership
- Ribosomal protein S18 (IPR001648)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_01621_1 MQPFTSRAVAFSKQGSRQFSSFSSGLLSKRGSKSTFKTSIPSSKNSNSAIKQTTSFLQQTEEEVIDPIFKKSFVPGSVYD PFDFSLTKLRIEQKENSNRVLDGIHIKHPGVDPLTLWKYPSILGNFVNSNGKIRLGVLYGHSGKTHKRLAKAIRRARAAG LLSYFTN
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome