Protein
MCA_01072_1
Length
110 amino acids
Gene name: COX19
Description: Cytochrome c oxidase assembly protein COX19
Browser: contigA:3403913-3404335-
RNA-seq: read pairs 2293, FPKM 255.2, percentile rank 90.6% (100% = highest expression)
Protein function
| Annotation: | COX19 | Cytochrome c oxidase assembly protein COX19 | |
|---|---|---|---|
| KEGG: | K18183 | COX19 | cytochrome c oxidase assembly protein subunit 19 |
| EGGNOG: | 0PRY2 | COX19 | Cytochrome c oxidase assembly protein cox19 |
| SGD closest match: | S000007245 | COX19 | Cytochrome c oxidase assembly protein COX19 |
| CGD closest match: | CAL0000176572 | COX19 | Cytochrome c oxidase assembly protein COX19 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01518_1 | 80.43% | 92 | 3e-51 | MIA_01518_1 |
| A0A0J9XK26_GEOCN | 74.19% | 93 | 6e-48 | Similar to Saccharomyces cerevisiae YLL018C-A COX19 Protein required for cytochrome c oxidase assembly OS=Geotrichum candidum GN=BN980_GECA32s00120g PE=4 SV=1 |
| A0A060TH79_BLAAD | 66.25% | 80 | 5e-37 | ARAD1D36630p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D36630g PE=4 SV=1 |
| COX19_YEAST | 57.73% | 97 | 7e-37 | Cytochrome c oxidase assembly protein COX19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX19 PE=1 SV=1 |
| UniRef50_Q3E731 | 57.73% | 97 | 2e-33 | Cytochrome c oxidase assembly protein COX19 n=47 Tax=Opisthokonta TaxID=33154 RepID=COX19_YEAST |
| A0A1E3PDW6_9ASCO | 71.43% | 77 | 8e-35 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53268 PE=4 SV=1 |
| B5FVG7_YARLI | 62.50% | 88 | 2e-33 | YALI0E34540p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E34540g PE=4 SV=1 |
| COX19_CANAL | 60.00% | 80 | 6e-33 | Cytochrome c oxidase assembly protein COX19 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX19 PE=3 SV=2 |
| A0A1E4TJ42_9ASCO | 56.25% | 80 | 2e-27 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_16218 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0210
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_01072_1 MASGGPGAGFSNWLPAPPERGSFPLDHDSECSTIMKDYLTCLKLVHGTNAHGCRLLAKSYLKCRMDHGLMDHDEWKNLGL PEDDKPIIPRKLDDPSSNKSTESTNQSPPS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.