Protein
MCA_00863_1
Length
159 amino acids
Gene name: AIM11
Description: Altered inheritance of mitochondria protein 11
Browser: contigA:2730611-2731091-
RNA-seq: read pairs 901, FPKM 69.6, percentile rank 72.5% (100% = highest expression)
Protein function
| Annotation: | AIM11 | Altered inheritance of mitochondria protein 11 | |
|---|---|---|---|
| EGGNOG: | 0PQFR | AIM11 | Altered inheritance of mitochondria protein 11 |
| SGD closest match: | S000002960 | AIM11 | Altered inheritance of mitochondria protein 11 |
| CGD closest match: | CAL0000201599 | AIM11 | Altered inheritance of mitochondria protein 11 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06075_1 | 61.38% | 145 | 4e-49 | MIA_06075_1 |
| A0A0J9XHW5_GEOCN | 56.25% | 144 | 2e-43 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA18s00923g PE=4 SV=1 |
| UniRef50_A0A0J9XHW5 | 56.25% | 144 | 3e-40 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHW5_GEOCN |
| A0A1E3PI28_9ASCO | 37.98% | 129 | 4e-21 | Altered inheritance of mitochondria protein 11 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51475 PE=4 SV=1 |
| AIM11_CANAL | 33.59% | 131 | 3e-16 | Altered inheritance of mitochondria protein 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AIM11 PE=3 SV=1 |
| AIM11_YARLI | 33.79% | 145 | 2e-13 | Altered inheritance of mitochondria protein 11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AIM11 PE=3 SV=1 |
| AIM11_YEAST | 28.03% | 132 | 3e-10 | Altered inheritance of mitochondria protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM11 PE=1 SV=2 |
| A0A1E4TH15_9ASCO | 32.26% | 124 | 5e-08 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_115732 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0235
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_00863_1 MSQPTQQLETPSTPVYVAPKAPKRTEDELKSLQTKQMLAFIGLGAISVTTALMGRRSVLSRQFTPHLFDSNNKPPSFNLV KDAAVAVAIASTMAVSTFAFTLTGFSWLAGIGSLKEFSLKAKSLMGGLEKEAVYLNAPEDPELEKLGESFEQVLGTKKS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.