Protein
MCA_00260_1
Length
243 amino acids
Gene name: COQ4
Description: Ubiquinone biosynthesis protein COQ4, mitochondrial
Browser: contigA:801348-802080-
RNA-seq: read pairs 828, FPKM 41.9, percentile rank 61.4% (100% = highest expression)
Protein function
| Annotation: | COQ4 | Ubiquinone biosynthesis protein COQ4, mitochondrial | |
|---|---|---|---|
| KEGG: | K18586 | COQ4 | ubiquinone biosynthesis protein COQ4 |
| EGGNOG: | 0PGMW | COQ4 | Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides (By similarity) |
| SGD closest match: | S000002612 | COQ4 | Ubiquinone biosynthesis protein COQ4, mitochondrial |
| CGD closest match: | CAL0000193093 | COQ4 | Ubiquinone biosynthesis protein COQ4, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05136_1 | 80.33% | 239 | 2e-144 | MIA_05136_1 |
| A0A161HFY7_9ASCO | 75.73% | 239 | 2e-136 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Sugiyamaella lignohabitans GN=COQ4 PE=3 SV=1 |
| A0A0J9YHE8_GEOCN | 74.79% | 234 | 7e-130 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Geotrichum candidum GN=COQ4 PE=3 SV=1 |
| A0A060TBT9_BLAAD | 72.65% | 234 | 2e-127 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Blastobotrys adeninivorans GN=COQ4 PE=3 SV=1 |
| A0A1E3PDJ9_9ASCO | 62.39% | 234 | 3e-108 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=COQ4 PE=3 SV=1 |
| UniRef50_C5JV83 | 59.40% | 234 | 5e-99 | Ubiquinone biosynthesis protein COQ4, mitochondrial n=10 Tax=leotiomyceta TaxID=716546 RepID=COQ4_BLAGS |
| A0A1E4T9H6_9ASCO | 60.87% | 230 | 4e-101 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=COQ4 PE=3 SV=1 |
| COQ4_YARLI | 58.97% | 234 | 5e-101 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COQ4 PE=3 SV=1 |
| COQ4_CANAL | 55.70% | 237 | 1e-95 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COQ4 PE=3 SV=2 |
| COQ4_YEAST | 49.78% | 231 | 1e-80 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ4 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6714
Protein family membership
- Ubiquinone biosynthesis protein Coq4 (IPR007715)
- Ubiquinone biosynthesis protein Coq4, eukaryotes (IPR027540)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_00260_1 MASTAVSRYPGHVPLNLFQHAFLFVGSGLAALKWPRRPDLVAVFGEASAEPCTVTRLRDLMLEDKTGRQILRERPRITST SLDLDKLRKLPPNTLGAEYIKWLDNEKVSPDTRLPVRYISDPECAYVMQRYRECHDFYHAITGLPVVMEGEVAVKAFEFA NLGIPMTGLAAFSEPFKLKPDQQQRLKDIYIPWALRNGLRSKLLLNIYWEHELESDANELRAKLGIDLPPNMRELRKKSK KKL
GO term prediction
Biological Process
GO:0006744 ubiquinone biosynthetic process
Molecular Function
None predicted.
Cellular Component
GO:0005743 mitochondrial inner membrane