Protein

MIA_mt_19350966

Length
543 amino acids

Browser: mtDNA:27951-37504+

Protein function

EGGNOG:0PJIYCOX1Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
SGD closest match:S000007260COX1Cytochrome c oxidase subunit 1
CGD closest match:CAL0000187344COX1Cytochrome c oxidase subunit 1

Protein alignments

%idAln lengthE-value
MCA_mt_1935106989.503%5430.0MCA_mt_19351069
A0A0A1I5J3_GEOCN86.506%5410.0Cytochrome c oxidase subunit 1 OS=Geotrichum candidum GN=cox1 PE=3 SV=1
A0A060RF32_BLAAD72.388%5360.0Cytochrome c oxidase subunit 1 OS=Blastobotrys adeninivorans GN=cox1 PE=3 SV=1
COX1_YEAST67.103%5350.0Cytochrome c oxidase subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX1 PE=3 SV=2
UniRef50_P0040167.103%5350.0Cytochrome c oxidase subunit 1 n=119 Tax=cellular organisms TaxID=131567 RepID=COX1_YEAST
COX1_YARLI64.060%5370.0Cytochrome c oxidase subunit 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX1 PE=3 SV=1
COX1_CANAL59.322%5310.0Cytochrome c oxidase subunit 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2723
Predicted cleavage: 183

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 500 543

Detailed signature matches

  1. Family IPR000883
    Cytochrome c oxidase subunit I
    1. PF00115 (COX1)
    2. PR01165 (CYCOXIDASEI)
  2. Domain IPR023616
    Cytochrome c oxidase-like, subunit I domain
    1. SSF81442 (Cytochrom...)
    2. G3DSA:1.20.21...
    3. PS50855 (COX1)
  3. Domain IPR033944
    Cytochrome c oxidase subunit I domain
    1. cd01663 (Cyt_c_Oxid...)
  4. SITE IPR023615
    Cytochrome c oxidase, subunit I, copper-binding site
    1. PS00077 (COX1_CUB)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. Coil
  3. NON_CYTOPLASM... (N...)
  4. TMhelix
  5. TRANSMEMBRANE (Tran...)

Residue annotation

  1. Subunit I/III inte...
  2. D-pathway cd01663
  3. Subunit I/VIIc int...
  4. Subunit I/IV inter...
  5. Subunit I/II inter...
  6. Low-spin heme (hem...
  7. Subunit I/VIIa int...
  8. Subunit I/VIa inte...
  9. Dimer interface c...
  10. Putative water exi...
  11. K-pathway cd01663
  12. Binuclear center (...
  13. Subunit I/Vb inter...
  14. Putative proton ex...
  15. Subunit I/VIb inte...
  16. Subunit I/VIc inte...
  17. Electron transfer ...
  18. Subunit I/VIIIb in...
  19. Subunit I/VIIb int...

Protein sequence

>MIA_mt_19350966
MTNSNFKQFVTRWLFSTNCKDIAMLYLMLAVFSGLVGTGLSLIIRLELAGPTPQMLQNNGQVFNVVISAHAIFMIFFLVM
PMAVGFFGNYLVPLMLGCADMSLARLNNISFWLLVPSVLLALASTLVESGAGTGWTVYPPLSSVQSHSGPSVDLVMFSLH
ISGMSSLLGSMNFMVTVMNMRTNGITYSKLTLFSWAMVMTSVLLLLSLPVLASGLTMLLTDRNFNTSFFEVASGGDPVLY
QHLFWFFGHPEVYMLMMPGFGMVSHIVSAYAKKPVFGQLGMMYAMASIGFLGFCVWSHHMYVVGLDTDTRAYFTSATMMI
AMPTGVKMFSWLATLYGGSLRFTTPFLYAMGFMFLFTMGGVTGVCLANASLDIAFHDTYYVVAHFHYVLSLGAVFSLFAG
YYFWSPKMLGLYYNERLGQIQFTTFFIGANLTFMPLHFLGMQGMPRRMPNYPDAYLGWNYMASFGSMVSLVSLMLFFYIV
YNQLVYGLENKNTVAVANLYEPDFMESNLMFTNENHSMKASSIEWITSTPPALHTFSSPALQS

GO term prediction

Biological Process

GO:0009060 aerobic respiration
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004129 cytochrome-c oxidase activity
GO:0005506 iron ion binding
GO:0009055 electron carrier activity
GO:0020037 heme binding

Cellular Component

GO:0016021 integral component of membrane
GO:0045277 respiratory chain complex IV