Protein

MIA_mt_19350953

Length
255 amino acids

Browser: mtDNA:15456-16224+

Protein function

EGGNOG:0PJU9ATP6Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel
SGD closest match:S000007268ATP6ATP synthase subunit a
CGD closest match:CAL0000195054ATP6ATP synthase subunit a

Protein alignments

%idAln lengthE-value
MCA_mt_1935106281.961%2551.40e-132MCA_mt_19351062
A0A0A1I5A1_GEOCN77.823%2481.67e-123ATP synthase subunit a OS=Geotrichum candidum GN=ATP6 PE=3 SV=1
A0A060RF29_BLAAD53.200%2505.68e-77ATP synthase subunit a OS=Blastobotrys adeninivorans GN=atp6 PE=3 SV=1
UniRef50_A0A060RF2953.200%2501.40e-73ATP synthase subunit a n=2 Tax=saccharomyceta TaxID=716545 RepID=A0A060RF29_BLAAD
ATP6_YARLI52.756%2541.60e-75ATP synthase subunit a OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP6 PE=3 SV=2
ATP6_YEAST54.331%2548.79e-73ATP synthase subunit a OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP6 PE=1 SV=2
ATP6_CANAL46.215%2513.81e-56ATP synthase subunit a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP6 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1450

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR000568
    ATP synthase, F0 complex, subunit A
    1. PR00123 (ATPASEA)
    2. G3DSA:1.20.12...
    3. PF00119 (ATP-synt_A)
    4. MF_01393 (ATP_synth...)
    5. SSF81336 (F1F0 ATP ...)
    6. TIGR01131
  2. SITE IPR023011
    ATP synthase, F0 complex, subunit A, active site
    1. PS00449 (ATPASE_A)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_mt_19350953
MRNMMMNSPLEQFEMNTYMSLNSSLIDLSWLSMTNFSMYSLIVFSLMMGLHTLSMNNNGIIPSKWSMGMESLYSTMQNMV
YSQIGMSGQYYFPLMYVLFMFMLVSNLFSMMPYNFAIMSHLVFTVSLSAMMWLGVTMLGFSNFKLEYFGLFVPAGTSLPL
VPILVIIELLSNTARSISLGLRLGSNILAGHLLLVMLGGLMFDFMSSGVMFFIVGFIPLALVLGIMCLECAMALIQAYVF
SILACSYIKEAIYLH

GO term prediction

Biological Process

GO:0015986 ATP synthesis coupled proton transport

Molecular Function

GO:0015078 hydrogen ion transmembrane transporter activity

Cellular Component

GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)