Protein

MIA_mt_19350952

Length
48 amino acids

Browser: mtDNA:15164-15311+

Protein alignments

%idAln lengthE-value

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0793

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR009230
    ATP synthase protein 8, fungi
    1. PF05933 (Fun_ATP-sy...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_mt_19350952
MPQLVPFYFVNQLVYGLSFMLMLLYMFSQYMLPRMLFMFLSRMFMTKL

GO term prediction

Biological Process

GO:0015986 ATP synthesis coupled proton transport

Molecular Function

GO:0015078 hydrogen ion transmembrane transporter activity

Cellular Component

GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)