Protein
MIA_06329_1
Length
180 amino acids
Browser: contig11:96715-97258+
Protein function
EGGNOG: | 0PQSV | PGUG_03408 | mitochondrial 54S ribosomal protein YmL36 |
---|---|---|---|
SGD closest match: | S000000326 | MRPL36 | 54S ribosomal protein L36, mitochondrial |
CGD closest match: | CAL0000174888 | MRPL36 | Mitochondrial 54S ribosomal protein YmL36 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9X4G1_GEOCN | 62.366% | 186 | 8.90e-80 | Similar to Saccharomyces cerevisiae YBR122C MRPL36 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA02s04839g PE=4 SV=1 |
MCA_01972_1 | 61.538% | 156 | 6.46e-67 | MCA_01972_1 |
A0A167CH40_9ASCO | 51.852% | 162 | 1.45e-55 | Mitochondrial 54S ribosomal protein YmL36 OS=Sugiyamaella lignohabitans GN=MRPL36 PE=4 SV=1 |
UniRef50_A0A167CH40 | 51.852% | 162 | 3.99e-52 | Mitochondrial 54S ribosomal protein YmL36 n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A167CH40_9ASCO |
A0A1E3PNE4_9ASCO | 47.468% | 158 | 3.70e-43 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45195 PE=4 SV=1 |
A0A060T4C8_BLAAD | 44.172% | 163 | 4.75e-43 | ARAD1C43934p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C43934g PE=4 SV=1 |
RM36_YEAST | 44.444% | 162 | 9.19e-38 | 54S ribosomal protein L36, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL36 PE=1 SV=3 |
A0A1E4TEN1_9ASCO | 48.276% | 87 | 5.48e-26 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13950 PE=4 SV=1 |
Q6C5W3_YARLI | 32.540% | 126 | 9.06e-19 | YALI0E14641p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E14641g PE=4 SV=1 |
Q59YH5_CANAL | 35.385% | 130 | 5.33e-15 | Mitochondrial 54S ribosomal protein YmL36 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRPL36 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9786
Predicted cleavage: 30
Protein family membership
- Ribosomal protein L31 (IPR002150)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01197 (Ribosomal_L31)
-

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_06329_1 MLTSLLNELRPGFSALRNNGVNLSQTRNYAIPGSGRSVLTRRAKRKLIPGKTRPSIFHMFECKVELSDGSTYVRRSQYPR VEWRYLADQRNHPLYNPSRSNLKVVEADATGRLAKFKQKYGFVQPVDSADRKDSAENNKPAEASKESSKPVIDDYLDLMS EGYVPVQSGGKLAKNKRGKK
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome