Protein
MIA_06322_1
Length
115 amino acids
Browser: contig11:78550-78938-
Protein function
CGD closest match: | CAL0000175624 | orf19.4167 | Uncharacterized protein |
---|
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_01958_1 | 47.573% | 103 | 1.41e-28 | MCA_01958_1 |
A0A0J9X6N5_GEOCN | 42.017% | 119 | 2.20e-20 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA04s00846g PE=4 SV=1 |
UniRef50_A0A0J9X6N5 | 42.017% | 119 | 4.49e-17 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X6N5_GEOCN |
A0A1E3PL53_9ASCO | 38.710% | 93 | 1.09e-13 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_41566 PE=4 SV=1 |
A0A060T967_BLAAD | 36.047% | 86 | 5.80e-11 | ARAD1D13222p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D13222g PE=4 SV=1 |
A0A1D8PL44_CANAL | 33.333% | 87 | 2.17e-07 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4167 PE=4 SV=1 |
Q6CI33_YARLI | 38.028% | 71 | 4.12e-07 | YALI0A02156p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A02156g PE=4 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0655
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
Protein sequence
>MIA_06322_1 MNPSTTPKLQAKVRKDQSDEEFLAQKTLWETTGPIIQGSEVRYTGFNLNRDYTNAQVKIDRTALRHAIERCLYLRDYDQA LKILNQGSQSVTNDRERADLESLHQTITQIKNNCQ
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.