Protein
MIA_06133_1
Length
417 amino acids
Browser: contig10:342904-344158-
Protein function
| EGGNOG: | 0PG17 | UFD1 | ubiquitin fusion degradation protein |
|---|---|---|---|
| SGD closest match: | S000003280 | UFD1 | Ubiquitin fusion degradation protein 1 |
| CGD closest match: | CAL0000194981 | orf19.5833 | Polyubiquitin-binding protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02684_2 | 64.644% | 379 | 2.22e-158 | MCA_02684_2 |
| A0A060TAW6_BLAAD | 54.424% | 373 | 1.25e-129 | ARAD1D23408p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D23408g PE=4 SV=1 |
| A0A0J9XJC3_GEOCN | 52.094% | 382 | 2.62e-129 | Similar to Saccharomyces cerevisiae YGR048W UFD1 Protein that interacts with Cdc48p and Npl4p segregase OS=Geotrichum candidum GN=BN980_GECA21s01176g PE=4 SV=1 |
| UniRef50_A0A0J9XJC3 | 52.094% | 382 | 5.36e-126 | Similar to Saccharomyces cerevisiae YGR048W UFD1 Protein that interacts with Cdc48p and Npl4p segregase n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XJC3_GEOCN |
| A0A167FEQ3_9ASCO | 50.743% | 404 | 4.60e-124 | Polyubiquitin-binding protein UFD1 OS=Sugiyamaella lignohabitans GN=UFD1 PE=4 SV=1 |
| Q6C4J6_YARLI | 50.265% | 378 | 3.55e-112 | YALI0E26235p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E26235g PE=4 SV=1 |
| A0A1E3PI59_9ASCO | 46.597% | 382 | 3.88e-109 | UFD1-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_35262 PE=4 SV=1 |
| Q5A0H8_CANAL | 50.269% | 372 | 6.69e-108 | Polyubiquitin-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5833 PE=4 SV=1 |
| A0A1E4TKG9_9ASCO | 48.468% | 359 | 3.03e-103 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_21097 PE=4 SV=1 |
| UFD1_YEAST | 46.073% | 382 | 7.96e-99 | Ubiquitin fusion degradation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6897
Predicted cleavage: 14
Protein family membership
- Ubiquitin fusion degradation protein Ufd1-like (IPR004854)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_06133_1 MKKRSISNYNQCQFPFSNNQNFFPGGWGVGAADFPPTNQKFQQFFRCYPIAMMPGNPRDELNYGGKIILPPSSLNKLTRL HISYPMLFALESAESGLVTHGGVLEFIAQEGLVYLPQWMMDALAVAPGSLVKVTNTSLNLGTFVKLEPQSTDFLEITDPK AVLENALRNYSTLTTDDVFQISYNDKIYGIRVVEVKPDSPSHSISVVETDLEVDFAPPVGYVEPVPDSRPGSVISAGGSN KAGNNTPGSISSGYATPTPLGQMARDINYEEILRKELAKSKINSFQGSGHKLAAGRSLGDRKGKGVSRNSNKDDEKQQEE NNEEISAKILSELPSTDAGPLTLPFGQLFFGFPIVPLKDIIVEEEIERNNDTGSVHHTFSGSGQSLRKSRKRKTQPSGQA PSSKKNSPSPSEIIELD
GO term prediction
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
Molecular Function
None predicted.
Cellular Component
None predicted.