Protein
MIA_05882_1
Length
366 amino acids
Browser: contig09:599995-601096+
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_05309_1 | 42.123% | 292 | 9.64e-51 | MCA_05309_1 |
A0A167E2K3_9ASCO | 33.935% | 277 | 1.37e-26 | Peripheral peroxisomal membrane peroxin OS=Sugiyamaella lignohabitans GN=AWJ20_1861 PE=4 SV=1 |
UniRef50_A0A167E2K3 | 33.935% | 277 | 3.76e-23 | Peripheral peroxisomal membrane peroxin n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167E2K3_9ASCO |
A0A0J9YHH0_GEOCN | 26.446% | 242 | 5.32e-14 | Similar to Saccharomyces cerevisiae YOL147C PEX11 Peroxisomal membrane protein required for medium-chain fatty acid oxidation and peroxisome proliferation OS=Geotrichum candidum GN=BN980_GECA01s04311g PE=4 SV=1 |
A0A060T5L1_BLAAD | 26.442% | 208 | 1.27e-13 | ARAD1B05170p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B05170g PE=4 SV=1 |
Q6C7T6_YARLI | 27.500% | 280 | 7.19e-13 | YALI0D25498p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D25498g PE=4 SV=1 |
A0A1E4TI93_9ASCO | 24.906% | 265 | 2.93e-13 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_71370 PE=4 SV=1 |
A0A1E3PET3_9ASCO | 23.721% | 215 | 4.44e-08 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52903 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2204
Protein family membership
- Peroxisomal biogenesis factor 11 (IPR008733)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_05882_1 MSNTTYHIPEDPIQALVEKTPEDLHPVPPVPSPGLSPHSPHGILADNKSSSPSSSGAPQPPPSGIFLPSPLLLPGPAPTR VAKAARAADSVDLFVHVFNTKDGKDKIIKIIQYTFRIVLWADASKVLHSTLLGTPQAGARKHRLTRSAVLYLLAIKWART MVPQLSMFRKIMRMGNWMEPLHLLLHTVPLQILQTHNIKSNVLTHSVLDAIIELYNAIFDDIYLFFKLGLVLKDRPKLGH RADLHANYAWLAAIALAFLGEHSNLWSQARRHERIAAEQALYQDAETLTPIQTQVVADLALEQYKVAQKRKISLLNSTKL ACDLVFCTIDILEAKTHPLIATGTGLTSALIGYYKIYHKLLQARLY
GO term prediction
Biological Process
GO:0016559 peroxisome fission
Molecular Function
None predicted.
Cellular Component
GO:0005779 integral component of peroxisomal membrane