Protein
MIA_05842_1
Length
44 amino acids
Browser: contig09:490054-490302+
Protein function
| EGGNOG: | 0PRUR | FG05210.1 | Transmembrane protein 167 |
|---|---|---|---|
| SGD closest match: | S000028698 | KSH1 | Protein kish |
| CGD closest match: | CAL0000187569 | CAALFM_CR06850CA | Protein kish |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00772_2 | 84.091% | 44 | 5.13e-25 | MCA_00772_2 |
| UniRef50_A0A0D8JUT1 | 79.070% | 43 | 1.97e-19 | Protein kish n=15 Tax=Pezizomycotina TaxID=147538 RepID=A0A0D8JUT1_COCIM |
| A0A0J9X7S7_GEOCN | 75.000% | 44 | 3.50e-22 | Protein kish OS=Geotrichum candidum GN=BN980_GECA04s06373g PE=3 SV=1 |
| B5FVD7_YARLI | 76.744% | 43 | 3.28e-20 | Protein kish OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D03949g PE=3 SV=1 |
| A0A1E4TDB1_9ASCO | 72.093% | 43 | 8.13e-20 | Protein kish OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_143001 PE=3 SV=1 |
| A0A1E3PPD0_9ASCO | 61.364% | 44 | 5.19e-19 | Protein kish OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45432 PE=3 SV=1 |
| KISH_YEAST | 62.500% | 40 | 6.37e-13 | Protein kish OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSH1 PE=3 SV=1 |
| A0A1D8PTB6_CANAL | 58.537% | 41 | 5.87e-13 | Protein kish OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR06850CA PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0060
Predicted cleavage: 27
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_05842_1 MPGIIDRNKHGFLGIFWKTARIGERLSPWVSLCCIAMAITLLIN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.