MIA_05792_1
Browser: contig09:345973-346931-
Protein function
EGGNOG: | 0PI7M | PUP2 | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) |
---|---|---|---|
SGD closest match: | S000003485 | PUP2 | Proteasome subunit alpha type-5 |
CGD closest match: | CAL0000186757 | PUP2 | Proteasome endopeptidase complex |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_05961_1 | 88.446% | 251 | 5.66e-167 | MCA_05961_1 |
A0A0J9XCK9_GEOCN | 87.200% | 250 | 6.54e-165 | Proteasome endopeptidase complex OS=Geotrichum candidum GN=BN980_GECA09s02254g PE=3 SV=1 |
A0A060T3I7_BLAAD | 80.952% | 252 | 1.47e-157 | Proteasome endopeptidase complex OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C37642g PE=3 SV=1 |
A0A1E3PLY5_9ASCO | 81.818% | 253 | 5.25e-157 | Proteasome endopeptidase complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82267 PE=3 SV=1 |
Q6C788_YARLI | 82.591% | 247 | 5.64e-154 | Proteasome endopeptidase complex OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E02794g PE=3 SV=1 |
UniRef50_I1RQ26 | 80.328% | 244 | 1.85e-149 | Proteasome subunit alpha type n=84 Tax=Eukaryota TaxID=2759 RepID=I1RQ26_GIBZE |
PSA5_YEAST | 78.486% | 251 | 4.84e-143 | Proteasome subunit alpha type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP2 PE=1 SV=2 |
Q59PZ1_CANAL | 80.080% | 251 | 1.42e-142 | Proteasome endopeptidase complex OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PUP2 PE=3 SV=1 |
A0A1E4TAM4_9ASCO | 78.088% | 251 | 6.88e-140 | Proteasome endopeptidase complex OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_128722 PE=3 SV=1 |
A0A167EJ58_9ASCO | 34.979% | 243 | 2.08e-40 | Proteasome endopeptidase complex OS=Sugiyamaella lignohabitans GN=PRE6 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2816
Protein family membership
- Proteasome, subunit alpha/beta (IPR001353)
- Proteasome alpha-type subunit (IPR023332)
- Proteasome subunit alpha5 (IPR033812)
- Proteasome alpha-type subunit (IPR023332)
Domains and repeats
-
Domain
-
Domain
Detailed signature matches

Residue annotation
-
alpha subunit inte...
-
active site cd03753
Protein sequence
>MIA_05792_1 MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSKGVVLGVEKRVTSSLLEPSSIEKIIEIDRHVGCAMSG LTADARTMIDHARVEATNHSFQYDEPIKVESITQSVCDLALRFGEGADGEERIMSRPFGVALLIAGFDENGPQLYHAEPS GTFYRYDAKAIGSGSEGAQVELQNEYHSSLTMEEAEVLVLKILKQVMEEKLDAKNAQLSSVTKDEGFKIYDDEMMKAVVE KMEAETTADDELQA
GO term prediction
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in cellular protein catabolic process
Molecular Function
GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity
Cellular Component
GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex