Protein

MIA_05792_1

Length
254 amino acids

Browser: contig09:345973-346931-

Protein function

EGGNOG:0PI7MPUP2The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000003485PUP2Proteasome subunit alpha type-5
CGD closest match:CAL0000186757PUP2Proteasome endopeptidase complex

Protein alignments

%idAln lengthE-value
MCA_05961_188.446%2515.66e-167MCA_05961_1
A0A0J9XCK9_GEOCN87.200%2506.54e-165Proteasome endopeptidase complex OS=Geotrichum candidum GN=BN980_GECA09s02254g PE=3 SV=1
A0A060T3I7_BLAAD80.952%2521.47e-157Proteasome endopeptidase complex OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C37642g PE=3 SV=1
A0A1E3PLY5_9ASCO81.818%2535.25e-157Proteasome endopeptidase complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82267 PE=3 SV=1
Q6C788_YARLI82.591%2475.64e-154Proteasome endopeptidase complex OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E02794g PE=3 SV=1
UniRef50_I1RQ2680.328%2441.85e-149Proteasome subunit alpha type n=84 Tax=Eukaryota TaxID=2759 RepID=I1RQ26_GIBZE
PSA5_YEAST78.486%2514.84e-143Proteasome subunit alpha type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP2 PE=1 SV=2
Q59PZ1_CANAL80.080%2511.42e-142Proteasome endopeptidase complex OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PUP2 PE=3 SV=1
A0A1E4TAM4_9ASCO78.088%2516.88e-140Proteasome endopeptidase complex OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_128722 PE=3 SV=1
A0A167EJ58_9ASCO34.979%2432.08e-40Proteasome endopeptidase complex OS=Sugiyamaella lignohabitans GN=PRE6 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2816

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 254

Detailed signature matches

  1. Family IPR001353
    Proteasome, subunit alpha/beta
    1. PF00227 (Proteasome)
  2. Family IPR023332
    Proteasome alpha-type subunit
    1. PS51475 (PROTEASOME...)
  3. Family IPR033812
    Proteasome subunit alpha5
    1. cd03753 (proteasome...)
  4. Domain IPR029055
    Nucleophile aminohydrolases, N-terminal
    1. G3DSA:3.60.20.10
    2. SSF56235 (N-termina...)
  5. Domain IPR000426
    Proteasome alpha-subunit, N-terminal domain
    1. PS00388 (PROTEASOME...)
    2. PF10584 (Proteasome...)
    3. SM00948 (Proteasome...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil

Residue annotation

  1. alpha subunit inte...
  2. active site cd03753

Protein sequence

>MIA_05792_1
MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSKGVVLGVEKRVTSSLLEPSSIEKIIEIDRHVGCAMSG
LTADARTMIDHARVEATNHSFQYDEPIKVESITQSVCDLALRFGEGADGEERIMSRPFGVALLIAGFDENGPQLYHAEPS
GTFYRYDAKAIGSGSEGAQVELQNEYHSSLTMEEAEVLVLKILKQVMEEKLDAKNAQLSSVTKDEGFKIYDDEMMKAVVE
KMEAETTADDELQA

GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex