Protein

MIA_05724_1

Length
75 amino acids


Browser: contig09:153204-153479+

Protein function

SGD closest match:S000003742NCE101Non-classical export protein 1
CGD closest match:CAL0000179973orf19.3181.1Uncharacterized protein

Protein alignments

%idAln lengthE-value
MCA_06272_156.061%665.28e-24MCA_06272_1
A0A0J9XEK3_GEOCN59.375%641.34e-23Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA10s04091g PE=4 SV=1
UniRef50_A0A0J9XEK359.375%642.75e-20Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XEK3_GEOCN
A0A1D8PNB0_CANAL49.057%537.90e-17Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3181.1 PE=4 SV=1
Q6CD29_YARLI48.649%371.75e-09YALI0C04257p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C04257g PE=4 SV=1
NCE1_YEAST33.333%485.32e-08Non-classical export protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCE101 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2940

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MIA_05724_1
MAAQPIIKYPYLISKALDPVFGFAVGIMAFGTYEKRVGREDGHTLKDLVIAKFKGTKAEPTLVETATSETASKSN

GO term prediction

Biological Process

GO:0009306 protein secretion

Molecular Function

None predicted.

Cellular Component

None predicted.