Protein

MIA_05719_1

Length
169 amino acids


Browser: contig09:138294-138856-

Protein function

EGGNOG:0PRZRDNL zinc finger domain-containing protein
SGD closest match:S000005254ZIM17Mitochondrial protein import protein ZIM17
CGD closest match:CAL0000182996orf19.6917Uncharacterized protein

Protein alignments

%idAln lengthE-value
MCA_05732_168.367%988.15e-40MCA_05732_1
A0A0J9XAR0_GEOCN82.609%691.85e-38Similar to Saccharomyces cerevisiae YNL310C ZIM17 Heat shock protein with a zinc finger motif OS=Geotrichum candidum GN=BN980_GECA07s02012g PE=4 SV=1
UniRef50_A0A0J9XAR082.609%693.79e-35Similar to Saccharomyces cerevisiae YNL310C ZIM17 Heat shock protein with a zinc finger motif n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XAR0_GEOCN
Q6C2Z1_YARLI77.273%668.78e-34YALI0F03949p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F03949g PE=4 SV=1
A0A1E3PMU1_9ASCO71.642%672.69e-32Zf-DNL-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82480 PE=4 SV=1
ZIM17_YEAST60.000%703.71e-26Mitochondrial protein import protein ZIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZIM17 PE=1 SV=2
A0A1E4TI94_9ASCO65.672%674.12e-27Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_22309 PE=4 SV=1
A0A1D8PQU2_CANAL55.000%601.84e-16Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6917 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9779
Predicted cleavage: 50

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 169

Detailed signature matches

    1. PF05180 (zf-DNL)
    2. PS51501 (ZF_DNL)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_05719_1
MKSVTTYARQALRLQGIAVRGLLLTRSVRPVHVARNPVAGPSVWINRRFNSGLAPSNNNSNNNNDDGDGKPEKPSYHLSF
TCKKCDTRSGHVISKQAYHGGTVLVQCPGCKSRHLIADHLKIFSDERVTLEDILAKKGQTIKKGITHTTDITTRVTPTGD
IEIETVKPE

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0008270 zinc ion binding

Cellular Component

None predicted.