Protein
MIA_05701_1
Length
127 amino acids
Browser: contig09:102710-103238+
Protein function
| EGGNOG: | 0PPQE | VMA7 | Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity) |
|---|---|---|---|
| SGD closest match: | S000003252 | VMA7 | V-type proton ATPase subunit F |
| CGD closest match: | CAL0000194906 | VMA7 | V-type proton ATPase subunit F |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_06229_1 | 86.614% | 127 | 1.56e-82 | MCA_06229_1 |
| A0A0J9XFC2_GEOCN | 81.102% | 127 | 6.94e-70 | V-type proton ATPase subunit F OS=Geotrichum candidum GN=BN980_GECA11s03640g PE=3 SV=1 |
| A0A1E3PG24_9ASCO | 79.508% | 122 | 4.24e-67 | V-type proton ATPase subunit F OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83863 PE=3 SV=1 |
| Q6C5Q2_YARLI | 77.869% | 122 | 2.40e-66 | V-type proton ATPase subunit F OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E16192g PE=3 SV=1 |
| UniRef50_A0A1S9RKJ4 | 71.545% | 123 | 1.21e-58 | V-type proton ATPase subunit F n=14 Tax=Eurotiomycetes TaxID=147545 RepID=A0A1S9RKJ4_9EURO |
| A0A1E4TLI9_9ASCO | 66.667% | 123 | 1.52e-61 | V-type proton ATPase subunit F OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30709 PE=3 SV=1 |
| A0A060SZS0_BLAAD | 75.926% | 108 | 3.87e-52 | V-type proton ATPase subunit F OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C10670g PE=3 SV=1 |
| A0A1D8PH17_CANAL | 63.866% | 119 | 8.34e-52 | V-type proton ATPase subunit F OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VMA7 PE=3 SV=1 |
| VATF_YEAST | 65.833% | 120 | 3.92e-51 | V-type proton ATPase subunit F OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA7 PE=1 SV=1 |
| A0A167FMF4_9ASCO | 66.667% | 81 | 1.49e-32 | H(+)-transporting V1 sector ATPase subunit F OS=Sugiyamaella lignohabitans GN=VMA7 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0850
Protein family membership
- ATPase, V1 complex, subunit F (IPR008218)
- ATPase, V1 complex, subunit F, eukaryotic (IPR005772)
Domains and repeats
None predicted.
Detailed signature matches
-
-
-
PIRSF015945 (V-ATP_...)
-
-
Protein sequence
>MIA_05701_1 MSAPSSQTYKNRQLLAVIGDEDSVTGLLLAGIGQISETDGGEKVKNFFVVDAKTTPEAIEATFDDYTQNRKDIAVLLINQ HVADKIRYRVDTYTQAFPAVLEIPSKDHPYDPEKDSVLRRVRRLFGE
GO term prediction
Biological Process
GO:0015991 ATP hydrolysis coupled proton transport
GO:0034220 ion transmembrane transport
Molecular Function
GO:0046961 proton-transporting ATPase activity, rotational mechanism
Cellular Component
GO:0033180 proton-transporting V-type ATPase, V1 domain