Protein
MIA_05653_1
Length
198 amino acids
Browser: contig08:1009101-1009723+
Protein function
| EGGNOG: | 0PS74 | Kinetochore protein Mis14 like | |
|---|---|---|---|
| SGD closest match: | S000006154 | NSL1 | Kinetochore-associated protein NSL1 |
| CGD closest match: | CAL0000181763 | orf19.6537 | MIND complex subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XGV2_GEOCN | 35.870% | 184 | 1.28e-33 | Similar to Saccharomyces cerevisiae YPL233W NSL1 Essential component of the MIND kinetochore complex OS=Geotrichum candidum GN=BN980_GECA16s00824g PE=4 SV=1 |
| UniRef50_A0A0J9XGV2 | 35.870% | 184 | 2.62e-30 | Similar to Saccharomyces cerevisiae YPL233W NSL1 Essential component of the MIND kinetochore complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XGV2_GEOCN |
| A0A060TB69_BLAAD | 36.552% | 145 | 5.12e-26 | ARAD1B13398p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B13398g PE=4 SV=1 |
| A0A1E3PH91_9ASCO | 37.037% | 135 | 1.77e-24 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_66985 PE=4 SV=1 |
| Q6CFR6_YARLI | 32.919% | 161 | 8.43e-22 | YALI0B04466p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B04466g PE=4 SV=1 |
| MCA_03192_1 | 26.432% | 227 | 1.93e-15 | MCA_03192_1 |
| A0A167FZ03_9ASCO | 31.496% | 127 | 2.16e-15 | MIND complex subunit NSL1 OS=Sugiyamaella lignohabitans GN=NSL1 PE=4 SV=1 |
| Q5AH01_CANAL | 27.273% | 143 | 1.64e-13 | MIND complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6537 PE=4 SV=1 |
| NSL1_YEAST | 26.724% | 116 | 1.83e-06 | Kinetochore-associated protein NSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSL1 PE=1 SV=1 |
| A0A1E4TF17_9ASCO | 23.571% | 140 | 4.52e-06 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2015 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0088
Protein family membership
- Kinetochore Mis14/Nsl1 (IPR013950)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF08641 (Mis14)
-
Protein sequence
>MIA_05653_1 MNGNIELKLQLSHNDVHFLRNLIVDAANLKINFHLPFQNQTEKDESRQLEDPMRDQVKELVHQFVYDTFEMARYGLVVDG TDISKKSASLAQTLKEMEDDNIEPFDQEINDELKDTYALVDELILEISNIRQKVPHEILKIYANSLKGSKQFNQKHETDV LVNFVKDEDIIKQNIKCLQEEYYKNLEQFKNLKKSEKD
GO term prediction
Biological Process
GO:0000070 mitotic sister chromatid segregation
Molecular Function
None predicted.
Cellular Component
GO:0000776 kinetochore