Protein

MIA_05579_1

Length
410 amino acids

Browser: contig08:865247-866480+

Protein function

EGGNOG:0PIXIOPSBprotease
SGD closest match:S000004111YPS3Aspartic proteinase yapsin-3
CGD closest match:CAL0000194661SAP9Candidapepsin-9

Protein alignments

%idAln lengthE-value
MCA_01994_179.268%4100.0MCA_01994_1
A0A060T356_BLAAD53.922%4086.99e-151ARAD1A13376p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A13376g PE=3 SV=1
A0A167E3R7_9ASCO50.510%3923.96e-140Yps3p OS=Sugiyamaella lignohabitans GN=YPS3 PE=3 SV=1
UniRef50_A0A167E3R750.510%3921.09e-136Yps3p n=2 Tax=Trichomonascaceae TaxID=410830 RepID=A0A167E3R7_9ASCO
M1XFD0_GEOCN37.379%4123.05e-76Aspartic protease OS=Geotrichum candidum GN=YSP3 PE=3 SV=1
Q6C6E4_YARLI34.988%4031.75e-63YALI0E10175p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10175g PE=3 SV=1
YPS3_YEAST33.182%4401.03e-56Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1
A0A1E3PJQ9_9ASCO34.097%3931.84e-55Acid protease OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46336 PE=3 SV=1
CARP9_CANAL38.436%3071.51e-52Candidapepsin-9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP9 PE=1 SV=2
A0A1E4TI13_9ASCO28.235%3402.97e-27Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_123212 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0768

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 410

Detailed signature matches

  1. Family IPR001461
    Aspartic peptidase A1 family
    1. PR00792 (PEPSIN)
  2. Domain IPR021109
    Aspartic peptidase domain
    1. G3DSA:2.40.70.10
    2. SSF50630 (Acid prot...)
  3. Domain IPR033121
    Peptidase family A1 domain
    1. PS51767 (PEPTIDASE_A1)
    2. PF00026 (Asp)
  4. Domain IPR033876
    Secreted aspartic endopeptidase
    1. cd05474 (SAP_like)
  5. SITE IPR001969
    Aspartic peptidase, active site
    1. PS00141 (ASP_PROTEASE)
Unintegrated signatures no IPR
Unintegrated signatures
  1. NON_CYTOPLASM... (N...)
  2. SIGNAL_PEPTIDE (Sig...)
  3. SIGNAL_PEPTID... (S...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. SignalP-noTM

Residue annotation

  1. inhibitor binding ...
  2. catalytic residue ...
  3. catalytic motif cd...
  4. Active site flap c...

Protein sequence

>MIA_05579_1
MKFSSLAIAAFLTIPGALADEVPAGALLLNVKRSEIPLSEESKLKRRDGNTAIGNAIEDKINNKKFYYTTTVQIGTPAQD
VELLLDTGSSDTWVFSPNSKYTGNQGGPKSFFDESKSTTWKGNNTNFHITYGIGQVTGKWGTDNLSIGGATINDLSIGIA
DSTDSAQGIVGIGRPQAEITSKTGNKYANLPLKLYENGHISSPAFSLYLNDIGSDSGSILFGAVDHSKYSGKLVSMDVSH
PVHYGTTLNSIRAQGIAGSNILNKPMTAILDSGTTLSYLPNDALINLHTNLNANPSFTINQRYYCDCNITQYLQFDFQGQ
SIKVPNYQFLWPIEQFVNPVVSSVAFPRNSCLVGFEATPQGADYVLLGDNILRSAYIVYDPSHNKVALAQADFSKTKSEI
ELIKKDIPSK

GO term prediction

Biological Process

GO:0006508 proteolysis

Molecular Function

GO:0004190 aspartic-type endopeptidase activity

Cellular Component

None predicted.