Protein
MIA_05574_1
Length
121 amino acids
Browser: contig08:850610-851042-
Protein function
EGGNOG: | 0PRAH | Rab5-interacting protein (Rab5ip) | |
---|---|---|---|
SGD closest match: | S000003937 | EMC6 | ER membrane protein complex subunit 6 |
CGD closest match: | CAL0000194391 | orf19.2698 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_02033_1 | 60.345% | 116 | 2.51e-43 | MCA_02033_1 |
A0A0J9XBH6_GEOCN | 49.533% | 107 | 7.30e-31 | Similar to Saccharomyces cerevisiae YLL014W EMC6 Member of a transmembrane complex required for efficient folding of proteins in the ER OS=Geotrichum candidum GN=BN980_GECA09s00164g PE=4 SV=1 |
UniRef50_A0A0J9XBH6 | 49.533% | 107 | 1.49e-27 | Similar to Saccharomyces cerevisiae YLL014W EMC6 Member of a transmembrane complex required for efficient folding of proteins in the ER n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBH6_GEOCN |
Q6CG99_YARLI | 46.491% | 114 | 6.91e-29 | YALI0A21010p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A21010g PE=4 SV=1 |
A0A1E3PMC0_9ASCO | 49.398% | 83 | 6.31e-23 | Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_23312 PE=4 SV=1 |
Q5AFA9_CANAL | 35.052% | 97 | 5.09e-18 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2698 PE=4 SV=1 |
EMC6_YEAST | 27.957% | 93 | 6.32e-13 | ER membrane protein complex subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC6 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0251
Protein family membership
- Rab5-interacting protein family (IPR029008)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_05574_1 MAPSKTLPKSQAQVKERELQISPLYIPNIVFNKLTISYIRNVTSLAFGICAGILQLESIYGFLFYFVASTLVSFLIQVLV VGRSPLSYLVTPKSDIFWSEIVSCLSSYVLMWTLFYGLVTA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.