Protein

MIA_05236_1

Length
132 amino acids


Browser: contig07:1097467-1097931+

Protein function

EGGNOG:0PQNUCGR1Involved in nucleolar integrity and required for processing of the pre-rRNA for the 60S ribosome subunit

Protein alignments

%idAln lengthE-value
A0A0J9YHG7_GEOCN46.364%1102.08e-11rRNA-processing protein OS=Geotrichum candidum GN=BN980_GECA01s04201g PE=3 SV=1
UniRef50_A0A0J9YHG746.364%1104.25e-08rRNA-processing protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9YHG7_GEOCN
A0A060T7T1_BLAAD48.421%951.14e-09ARAD1B22418p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22418g PE=4 SV=1
A0A161HJP4_9ASCO48.193%834.71e-07Cgr1p OS=Sugiyamaella lignohabitans GN=CGR1 PE=4 SV=1
A0A1E3PIF1_9ASCO40.426%472.53e-06rRNA-processing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42479 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0080

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF03879 (Cgr1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_05236_1
MPENDTNTAVEVPEVYTGTTSEEKREAPQTRKSNRTWREQKTPLRISALGVGKTAWEKRVQARTEAAAFKARVQEMKDEK
EGERRRRVEERAAREAAKQEKQRYAELAKKMHAKKLERLRRKEKRNKMLKER

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.