Protein
MIA_05236_1
Length
132 amino acids
Browser: contig07:1097467-1097931+
Protein function
EGGNOG: | 0PQNU | CGR1 | Involved in nucleolar integrity and required for processing of the pre-rRNA for the 60S ribosome subunit |
---|
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9YHG7_GEOCN | 46.364% | 110 | 2.08e-11 | rRNA-processing protein OS=Geotrichum candidum GN=BN980_GECA01s04201g PE=3 SV=1 |
UniRef50_A0A0J9YHG7 | 46.364% | 110 | 4.25e-08 | rRNA-processing protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9YHG7_GEOCN |
A0A060T7T1_BLAAD | 48.421% | 95 | 1.14e-09 | ARAD1B22418p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22418g PE=4 SV=1 |
A0A161HJP4_9ASCO | 48.193% | 83 | 4.71e-07 | Cgr1p OS=Sugiyamaella lignohabitans GN=CGR1 PE=4 SV=1 |
A0A1E3PIF1_9ASCO | 40.426% | 47 | 2.53e-06 | rRNA-processing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42479 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0080
Protein family membership
- Cgr1-like (IPR005579)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_05236_1 MPENDTNTAVEVPEVYTGTTSEEKREAPQTRKSNRTWREQKTPLRISALGVGKTAWEKRVQARTEAAAFKARVQEMKDEK EGERRRRVEERAAREAAKQEKQRYAELAKKMHAKKLERLRRKEKRNKMLKER
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.