Protein

MIA_05154_1

Length
287 amino acids

Browser: contig07:863692-864709-

Protein function

EGGNOG:0PJM1FG10180.1Coatomer subunit epsilon
CGD closest match:CAL0000189615orf19.5689Coatomer subunit epsilon

Protein alignments

%idAln lengthE-value
MCA_05820_147.203%2864.97e-77MCA_05820_1
A0A161HL27_9ASCO40.845%2847.90e-69Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_920 PE=4 SV=1
A0A0J9XC45_GEOCN39.116%2944.67e-63Coatomer subunit epsilon OS=Geotrichum candidum GN=BN980_GECA08s04476g PE=3 SV=1
UniRef50_A0A0J9XC4539.116%2949.56e-60Coatomer subunit epsilon n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XC45_GEOCN
A0A060TEV6_BLAAD41.980%2931.51e-56Coatomer subunit epsilon OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D11022g PE=3 SV=1
A0A1E3PEZ0_9ASCO33.217%2861.37e-47Coatomer subunit epsilon OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47681 PE=3 SV=1
A0A1E4TK55_9ASCO32.407%2164.67e-23Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_723 PE=4 SV=1
Q6C5Q9_YARLI27.647%1704.99e-17YALI0E15994p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E15994g PE=4 SV=1
A0A1D8PMT6_CANAL26.786%1681.96e-09Coatomer subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5689 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0099

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 287

Detailed signature matches

  1. Family IPR006822
    Coatomer, epsilon subunit
    1. PIRSF016478 (Epsilo...)
  2. Domain IPR011990
    Tetratricopeptide-like helical domain
    1. G3DSA:1.25.40.10
    2. SSF48452 (TPR-like)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PF04733 (Coatomer_E)

Protein sequence

>MIA_05154_1
MANTREVYNVQRAFYAGDYDAVIGTSTDSFSEAAAVYVNVLIARAKILLGRQPEVIEAFSSCSEGDEDYLAVSALAKYTL
GQKAVAVSEIENLISESSDNYTVQYIGGIILVSEERLEEAVELLNRDANIEAAALLIQVYLIQNQLETASQKIKAISSWA
QDNTAFNLAESWTFFRTGGYDRYQDSFYIYDELCSGGAITTKSLLGKIVSQLLLGRLPETESVVTQALEVEPENPDALIS
SISLAILSGQSYEEQEEKLKLAAPNHAYVKDIQAKNELFDELASKVY

GO term prediction

Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to ER

Molecular Function

GO:0005198 structural molecule activity
GO:0005515 protein binding

Cellular Component

None predicted.