Protein
MIA_05136_1
Length
258 amino acids
Browser: contig07:828909-829686-
Protein function
| EGGNOG: | 0PGMW | COQ4 | Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides (By similarity) |
|---|---|---|---|
| SGD closest match: | S000002612 | COQ4 | Ubiquinone biosynthesis protein COQ4, mitochondrial |
| CGD closest match: | CAL0000193093 | COQ4 | Ubiquinone biosynthesis protein COQ4, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00260_1 | 80.335% | 239 | 3.09e-146 | MCA_00260_1 |
| A0A161HFY7_9ASCO | 72.289% | 249 | 3.63e-136 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Sugiyamaella lignohabitans GN=COQ4 PE=3 SV=1 |
| A0A0J9YHE8_GEOCN | 75.000% | 232 | 9.71e-134 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Geotrichum candidum GN=COQ4 PE=3 SV=1 |
| A0A060TBT9_BLAAD | 68.908% | 238 | 2.37e-127 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Blastobotrys adeninivorans GN=COQ4 PE=3 SV=1 |
| A0A1E3PDJ9_9ASCO | 58.824% | 255 | 5.88e-110 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=COQ4 PE=3 SV=1 |
| UniRef50_C5JV83 | 57.661% | 248 | 3.37e-103 | Ubiquinone biosynthesis protein COQ4, mitochondrial n=10 Tax=leotiomyceta TaxID=716546 RepID=COQ4_BLAGS |
| COQ4_YARLI | 58.547% | 234 | 4.55e-105 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COQ4 PE=3 SV=1 |
| COQ4_CANAL | 56.667% | 240 | 1.50e-103 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COQ4 PE=3 SV=2 |
| A0A1E4T9H6_9ASCO | 59.565% | 230 | 7.19e-99 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=COQ4 PE=3 SV=1 |
| COQ4_YEAST | 48.963% | 241 | 1.50e-85 | Ubiquinone biosynthesis protein COQ4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ4 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3939
Protein family membership
- Ubiquinone biosynthesis protein Coq4 (IPR007715)
- Ubiquinone biosynthesis protein Coq4, eukaryotes (IPR027540)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_05136_1 MTNPLMSMSSALNATAHALPKYPGNVPLTPFQHLFLFVGSGIAAVLNPRRPDLVAVFGEASAEPYTVQRLRDSMLADAVG RRILRERPRITSTSLDLNRLRALPSNTLGSEYVRWLDTENVSPDTRAAVRYISDPECAYVMQRYRECHDFYHAVTGLPVV MEGEVAVKAFEFANMGIPMTGLAAFSEPFKLKADQQQRLCDIYIPWALTNGLRAKLLLNVYWEEQLERDADDLRKELGID LPPNMRALRKQAKKKVKA
GO term prediction
Biological Process
GO:0006744 ubiquinone biosynthetic process
Molecular Function
None predicted.
Cellular Component
GO:0005743 mitochondrial inner membrane