Protein

MIA_05131_1

Length
378 amino acids

Browser: contig07:823814-824951-

Protein function

EGGNOG:0PI0EMAP1Removes the N-terminal methionine from nascent proteins (By similarity)
SGD closest match:S000004234MAP1Methionine aminopeptidase 1
CGD closest match:CAL0000175273orf19.3124Methionine aminopeptidase

Protein alignments

%idAln lengthE-value
MCA_00270_177.778%3690.0MCA_00270_1
A0A1E3PI41_9ASCO74.114%3670.0Methionine aminopeptidase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83042 PE=3 SV=1
A0A0J9XH29_GEOCN72.207%3670.0Methionine aminopeptidase OS=Geotrichum candidum GN=BN980_GECA17s00736g PE=3 SV=1
A0A060TBT5_BLAAD70.380%3680.0Methionine aminopeptidase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B11132g PE=3 SV=1
Q6C8T4_YARLI68.407%3640.0Methionine aminopeptidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D17138g PE=3 SV=1
A0A1D8PMP9_CANAL65.940%3670.0Methionine aminopeptidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3124 PE=3 SV=1
UniRef50_A3GEY764.850%3671.93e-178Methionine aminopeptidase n=41 Tax=Fungi TaxID=4751 RepID=A3GEY7_PICST
MAP1_YEAST58.856%3677.83e-164Methionine aminopeptidase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAP1 PE=1 SV=2
A0A1E4TJ12_9ASCO58.333%3606.55e-154Methionine aminopeptidase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_75421 PE=3 SV=1
A0A167CE53_9ASCO66.337%3036.81e-143Methionine aminopeptidase OS=Sugiyamaella lignohabitans GN=MAP1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0527

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 378

Detailed signature matches

  1. Family IPR001714
    Peptidase M24, methionine aminopeptidase
    1. PR00599 (MAPEPTIDASE)
  2. Family IPR002467
    Peptidase M24A, methionine aminopeptidase, subfamily 1
    1. MF_01974 (MetAP_1)
    2. TIGR00500
    3. cd01086 (MetAP1)
    4. PS00680 (MAP_1)
  3. Domain IPR031615
    MYND-like zinc finger, mRNA-binding
    1. PF15801 (zf-C6H2)
  4. Domain IPR000994
    Peptidase M24
    1. SSF55920 (Creatinas...)
    2. PF00557 (Peptidase_M24)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.90.23...

Residue annotation

  1. active site cd01086

Protein sequence

>MIA_05131_1
MSATDDETRITQCCGSDCGKDTNTRLKCPTCLKNGVESVFCSQACFKRNWKTHKAVHPKADNEGKTYDPFPASVYTGTLR
ASYPLAPRRAVDAGIVLPDYARDGMPRSEQGARATTIEVLDKDGIEGMRKVCRIGREVLDAAAAAVKPGVTTDEIDAIVH
AECMKHKAYPSPLNYYHFPRSVCTSVNEVICHGIPDQRPLEDGDIVNLDISIYYGGYHADLNETYYVGDKAKSDPDTVRL
VETTRESLDLAIKTVKPGVLFRSFGDIIEKHAKANKLSVVRTYSGHGVNSLFHCPPNIPHYARNKAIGMAKAGVCFTIEP
MLNLGSYRDSMWPDNWTAVTVDGKRSAQFEHTLLVTEDGVEVLTARLPTSPGGPVPRV

GO term prediction

Biological Process

GO:0006508 proteolysis

Molecular Function

GO:0004177 aminopeptidase activity
GO:0008235 metalloexopeptidase activity

Cellular Component

None predicted.