Protein
MIA_05082_1
Length
231 amino acids
Browser: contig07:665377-666120+
Protein function
| EGGNOG: | 0PJP4 | SNF7 | Required for the sorting and concentration of proteins resulting in the entry of these proteins into the invaginating vesicles of the multivesicular body (MVB). Also required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH (By similarity) |
|---|---|---|---|
| SGD closest match: | S000004015 | SNF7 | Vacuolar-sorting protein SNF7 |
| CGD closest match: | CAL0000187201 | SNF7 | Vacuolar-sorting protein SNF7 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05720_1 | 89.726% | 146 | 3.57e-91 | MCA_05720_1 |
| A0A0J9X6T4_GEOCN | 75.352% | 142 | 9.17e-74 | Similar to Saccharomyces cerevisiae YLR025W SNF7 One of four subunits of the endosomal sorting complex required for transport III (ESCRT-III) OS=Geotrichum candidum GN=BN980_GECA04s01704g PE=3 SV=1 |
| A0A1E3PKF8_9ASCO | 62.162% | 148 | 4.29e-64 | Snf7-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82777 PE=3 SV=1 |
| A0A060TE81_BLAAD | 57.823% | 147 | 3.55e-57 | ARAD1D13398p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D13398g PE=3 SV=1 |
| A0A167E8X3_9ASCO | 61.905% | 147 | 8.61e-57 | ESCRT-III subunit protein SNF7 OS=Sugiyamaella lignohabitans GN=SNF7 PE=3 SV=1 |
| UniRef50_A0A1E4TU18 | 56.757% | 148 | 1.55e-46 | Uncharacterized protein n=1 Tax=Pachysolen tannophilus NRRL Y-2460 TaxID=669874 RepID=A0A1E4TU18_PACTA |
| A0A1E4THV8_9ASCO | 54.667% | 150 | 3.28e-53 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_122848 PE=3 SV=1 |
| SNF7_YARLI | 60.417% | 144 | 7.60e-49 | Vacuolar-sorting protein SNF7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SNF7 PE=3 SV=1 |
| SNF7_CANAL | 55.629% | 151 | 3.57e-47 | Vacuolar-sorting protein SNF7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SNF7 PE=3 SV=1 |
| SNF7_YEAST | 52.980% | 151 | 4.17e-44 | Vacuolar-sorting protein SNF7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF7 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0247
Protein family membership
- Snf7 family (IPR005024)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF03357 (Snf7)
-
no IPR
Unintegrated signatures
-
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_05082_1 MSGLFSMFFGNNEAKKDTPKKAIADLRMQITLLQKKEDYLTKQIEEQENLARKNVTTNKNLARTALRRKKMHEKNLEGLQ GQIDSLESQLNAIESANLNFETMKAMKQGSKALKHIHGNMNIDKVDQTMDEIEEQVTLGQEINNAISRPLAGLEMDDDEL NDELENLEQEVLEEKMVTGAGRAPVAIPGGTATTATPNTPAAKNAATPAKHEEEDSDEEEELRRLQAEMAL
GO term prediction
Biological Process
GO:0007034 vacuolar transport
Molecular Function
None predicted.
Cellular Component
None predicted.