Protein
MIA_05052_1
Length
258 amino acids
Browser: contig07:558469-559246+
Protein function
EGGNOG: | 0PGY4 | FG09374.1 | GPR FUN34 family protein |
---|---|---|---|
SGD closest match: | S000000603 | ADY2 | Accumulation of dyads protein 2 |
CGD closest match: | CAL0000177981 | FRP3 | Putative ammonium permease |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_05834_1 | 72.39% | 268 | 4e-115 | MCA_05834_1 |
A0A0J9X7N2_GEOCN | 68.91% | 267 | 8e-110 | Similar to Saccharomyces cerevisiae YCR010C ADY2 Acetate transporter required for normal sporulation OS=Geotrichum candidum GN=BN980_GECA04s05532g PE=4 SV=1 |
A0A167FZU3_9ASCO | 65.25% | 236 | 2e-91 | Putative ammonium permease ATO2 OS=Sugiyamaella lignohabitans GN=ATO2 PE=4 SV=1 |
A0A1E3PPP5_9ASCO | 54.68% | 267 | 9e-90 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49823 PE=4 SV=1 |
UniRef50_A0A161HWU2 | 52.89% | 242 | 2e-77 | Putative ammonium permease ATO2 n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A161HWU2_9ASCO |
GPR1_YARLI | 51.74% | 259 | 4e-75 | Glyoxylate pathway regulator OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPR1 PE=1 SV=3 |
ADY2_YEAST | 51.81% | 249 | 2e-74 | Accumulation of dyads protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADY2 PE=1 SV=1 |
A0A1D8PHP8_CANAL | 54.55% | 242 | 5e-72 | Putative ammonium permease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FRP3 PE=4 SV=1 |
A0A060T3E7_BLAAD | 37.22% | 266 | 5e-51 | ARAD1A09152p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A09152g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0109
Protein family membership
- Acetate transporter GPR1/FUN34/SatP family (IPR000791)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01184 (Grp1_Fun34...)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_05052_1 MSNFDLEKQGSHDSQPPQIARIQTSGQDNEILHIGDTKVYKDDLIAAFGGSLNVGLTHAPSRKFANPGPLGLSAFALTTF VLSLVNVRARGLKDPAGVVGLAFFYGGFIQLLAGMWEVVVENNFGATALSSYGGFWLAWGALETDAFGLRAAYATDSQWN DMVGFFLLGWLIFTTMMLCLTVKSTLAFFSLFLFLEITFLFLVIGHLGHTAVCNKIGGYFGIITALLAWYNAYAGLATRE NSYYVPKVIYMPGTVLPK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane