Protein

MIA_05050_1

Length
265 amino acids


Browser: contig07:554940-555738+

Protein function

EGGNOG:0PGY4FG09374.1GPR FUN34 family protein
SGD closest match:S000000603ADY2Accumulation of dyads protein 2
CGD closest match:CAL0000177981FRP3Putative ammonium permease

Protein alignments

%idAln lengthE-value
A0A0J9X7N2_GEOCN69.318%2645.39e-108Similar to Saccharomyces cerevisiae YCR010C ADY2 Acetate transporter required for normal sporulation OS=Geotrichum candidum GN=BN980_GECA04s05532g PE=4 SV=1
MCA_05834_165.799%2693.23e-101MCA_05834_1
A0A167FZU3_9ASCO58.333%2521.15e-82Putative ammonium permease ATO2 OS=Sugiyamaella lignohabitans GN=ATO2 PE=4 SV=1
A0A1E3PPP5_9ASCO50.936%2671.06e-73Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49823 PE=4 SV=1
UniRef50_A0A161HWU255.319%2352.72e-65Putative ammonium permease ATO2 n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A161HWU2_9ASCO
GPR1_YARLI47.490%2591.45e-59Glyoxylate pathway regulator OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPR1 PE=1 SV=3
A0A1D8PHP8_CANAL50.598%2514.50e-59Putative ammonium permease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FRP3 PE=4 SV=1
ADY2_YEAST48.413%2521.89e-58Accumulation of dyads protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADY2 PE=1 SV=1
A0A060T3E7_BLAAD39.834%2415.30e-43ARAD1A09152p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A09152g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0042

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF01184 (Grp1_Fun34...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_05050_1
MAAQDHFDLEKQLEYPEETGTGIARIQTSGQDNEILHIGDTKVYKHELMAAFGGSLNVGLSEAPSRKFANPGPLGLSAFA
LTTFCLSLVNVQARGVANASGVVGLAFFYGGFIQLLAGMWEIVVENNFGATALSSYGGFWLAWGALNTKSFGIRAAYATE
REWSEVVGFFLLGWLLFNTMLLMLTVKSTFVFFVLFLVVEFTFLFLTIGHIGHSPACNKIGGYFGLVASVLAWYNAYAGL
ATHENSYFVPKVIYMPGTVFPDKKK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

GO:0016021 integral component of membrane