Protein

MIA_04845_1

Length
367 amino acids

Browser: contig06:1123181-1124516-

Protein function

EGGNOG:0PH64PGUG_00809tRNA dihydrouridine synthase
SGD closest match:S000005298SMM1tRNA-dihydrouridine(20) synthase [NAD(P)+]
CGD closest match:CAL0000181192SMM1Smm1p

Protein alignments

%idAln lengthE-value
MCA_04838_169.01%3551e-178MCA_04838_1
A0A0J9XDC6_GEOCN62.60%3699e-153Similar to Saccharomyces cerevisiae YNR015W SMM1 Dihydrouridine synthase OS=Geotrichum candidum GN=BN980_GECA09s00417g PE=4 SV=1
A0A060T1D9_BLAAD61.54%3255e-149ARAD1C23958p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C23958g PE=4 SV=1
Q6C002_YARLI58.54%3282e-142tRNA-dihydrouridine synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F29205g PE=3 SV=1
UniRef50_Q6C00258.54%3284e-139tRNA-dihydrouridine synthase n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=Q6C002_YARLI
A0A1E3PLI3_9ASCO58.81%3523e-136FMN-linked oxidoreductase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_23165 PE=4 SV=1
A0A1E4TL68_9ASCO49.19%3094e-104Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_19618 PE=4 SV=1
DUS2_YEAST47.88%3301e-100tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMM1 PE=1 SV=1
A0A1D8PIL3_CANAL45.02%3315e-91Smm1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SMM1 PE=4 SV=1
A0A167F3N0_9ASCO61.69%2015e-85Smm1p OS=Sugiyamaella lignohabitans GN=SMM1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2911
Predicted cleavage: 32

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 367

Detailed signature matches

  1. Family IPR001269
    tRNA-dihydrouridine synthase
    1. PIRSF006621 (Dus)
    2. PF01207 (Dus)
  2. Domain IPR013785
    Aldolase-type TIM barrel
    1. G3DSA:3.20.20.70
  3. Domain IPR035587
    DUS-like, FMN-binding domain
    1. cd02801 (DUS_like_FMN)
  4. SITE IPR018517
    tRNA-dihydrouridine synthase, conserved site
    1. PS01136 (UPF0034)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF51395 (FMN-linke...)
  2. mobidb-lite (disord...)

Residue annotation

  1. FMN binding site c...
  2. active site cd02801
  3. catalytic residues...
  4. substrate binding ...

Protein sequence

>MIA_04845_1
MVDYKRALVLAPMVRVGELPTRLLSLKHGASLVWTPEVIDKKIISCRRVWNEKTRCYDFIEKNDKIAFRTCPEIEKDRLV
FQMGTSDPNLAVQAAKVVVNDVSAIDVNSGCPKHFSIHSGMGAALLKTPDKLVNILTSLVNQVGKPFNIPISVKIRLLES
EEKTLTLVERLVTTGIKCLTIHCRTTPMRPREPSIRLSLKKISDACHKAGVMCLLNGDVEGFNDLDFVIEKYGVDGAMIA
RAAEANPSCFNEKGLVPWNEIIKEYFEYCQKFDNHVSNTKFCLARMIPGKSELYQKVSRSKTMEEISEALSNVTEQETKK
YIHIFKSPLTLLQEQKEKDGLNEGKNKTLKRLAEELVEPSKKQKTSK

GO term prediction

Biological Process

GO:0008033 tRNA processing
GO:0055114 oxidation-reduction process

Molecular Function

GO:0003824 catalytic activity
GO:0017150 tRNA dihydrouridine synthase activity
GO:0050660 flavin adenine dinucleotide binding

Cellular Component

None predicted.