Protein

MIA_04786_1

Length
89 amino acids


Browser: contig06:978395-978714+

Protein function

EGGNOG:0PR40RSM19mitochondrial 37S ribosomal protein RSM19
SGD closest match:S000005320RSM1937S ribosomal protein S19, mitochondrial
CGD closest match:CAL0000198132CAALFM_CR07760WAMitochondrial 37S ribosomal protein RSM19

Protein alignments

%idAln lengthE-value
A0A0J9XA22_GEOCN83.146%896.75e-52Similar to Saccharomyces cerevisiae YNR037C RSM19 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA06s03607g PE=3 SV=1
A0A060T8M8_BLAAD73.034%891.70e-45ARAD1C30074p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C30074g PE=3 SV=1
RT19_YEAST69.663%891.53e-4437S ribosomal protein S19, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM19 PE=1 SV=1
UniRef50_P5373369.663%893.66e-4137S ribosomal protein S19, mitochondrial n=225 Tax=cellular organisms TaxID=131567 RepID=RT19_YEAST
MCA_05067_170.455%883.30e-44MCA_05067_1
A0A1E3PQ11_9ASCO67.416%891.22e-42Mitochondrial 37S ribosomal protein S19 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49821 PE=3 SV=1
A0A1E4TGR9_9ASCO61.628%863.39e-39Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_57337 PE=3 SV=1
A0A1D8PTL2_CANAL67.059%853.99e-38Mitochondrial 37S ribosomal protein RSM19 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR07760WA PE=3 SV=1
Q6CDN4_YARLI52.809%899.03e-30YALI0B22594p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B22594g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9432
Predicted cleavage: 11

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 89

Detailed signature matches

    1. MF_00531 (Ribosomal...)
    2. PIRSF002144 (RPS19p...)
    3. PF00203 (Ribosomal_S19)
    4. PR00975 (RIBOSOMALS19)
    1. SSF54570 (Ribosomal...)
    1. PS00323 (RIBOSOMAL_S19)

Protein sequence

>MIA_04786_1
MRPATVLFRRSAWKVPHIVPLPIREAMEKNTPIRTNARSGTILPHYVGLKFQVHNGMEYVAFEVTDDMVGSKLGDFAPTR
KRFSFKEDK

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome