Protein

MIA_04595_1

Length
146 amino acids

Browser: contig06:458785-459226-

Protein function

EGGNOG:0PPASRPL2560s ribosomal protein
SGD closest match:S000005487RPL2560S ribosomal protein L25
CGD closest match:CAL0000200350RPL25Ribosomal 60S subunit protein L25

Protein alignments

%idAln lengthE-value
MCA_02880_176.761%1422.38e-68MCA_02880_1
A0A0J9XDC3_GEOCN68.254%1261.13e-60Similar to Saccharomyces cerevisiae YOL127W RPL25 Ribosomal 60S subunit protein L25 OS=Geotrichum candidum GN=BN980_GECA10s03937g PE=3 SV=1
A0A060TJ14_BLAAD66.667%1266.10e-56ARAD1D43076p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D43076g PE=3 SV=1
A0A1E3PIY3_9ASCO65.873%1261.93e-54Putative ribosomal protein, large subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51975 PE=3 SV=1
UniRef50_Q75AT660.317%1264.18e-47ADL166Wp n=9 Tax=Opisthokonta TaxID=33154 RepID=Q75AT6_ASHGO
RL25_YEAST58.730%1264.71e-5060S ribosomal protein L25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL25 PE=1 SV=4
A0A1E4TET4_9ASCO54.762%1261.99e-50Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_26434 PE=3 SV=1
A0A1D8PPS1_CANAL57.143%1265.35e-50Ribosomal 60S subunit protein L25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL25 PE=3 SV=1
Q6C0E1_YARLI55.556%1266.29e-49YALI0F25531p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F25531g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9744
Predicted cleavage: 62

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 146

Detailed signature matches

  1. Family IPR013025
    Ribosomal protein L25/L23
    1. PF00276 (Ribosomal_L23)
    2. MF_01369_A (Ribosom...)
  2. Domain IPR005633
    Ribosomal protein L23/L25, N-terminal
    1. PF03939 (Ribosomal_...)
  3. Domain IPR012678
    Ribosomal protein L23/L15e core domain
    1. SSF54189 (Ribosomal...)
  4. SITE IPR001014
    Ribosomal protein L23/L25, conserved site
    1. PS00050 (RIBOSOMAL_L23)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...

Protein sequence

>MIA_04595_1
MFFLAATQKKALDAKKAVVKGSNSKKLIKVRSSVNFHRPKTLTLARAPKYQRKSISHYARLDAYKVVKSHVNSEVSIKKI
EDANTLVLTVDNKATKTDIKNAVKTLYNVEALKVNTLVRADGAKKAFVKLTPEHDALDVASRVGYI

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome