Protein

MIA_04582_1

Length
600 amino acids


Browser: contig06:428467-430270+

Protein function

EGGNOG:0PG36ERO1Essential oxidoreductase that oxidizes proteins in the endoplasmic reticulum to produce disulfide bonds. Acts by oxidizing directly pdi1 isomerase through a direct disulfide exchange. Does not act as a direct oxidant of folding substrate, but relies on pdi1 to transfer oxidizing equivalent. Does not oxidize all pdi related proteins, suggesting that it can discriminate between pdi1 and related proteins. Its reoxidation probably involves electron transfer to molecular oxygen via FAD. Acts independently of glutathione. May be responsible for a significant proportion of reactive oxygen species (ROS) in the cell, thereby being a source of oxidative stress
SGD closest match:S000004599ERO1Endoplasmic oxidoreductin-1
CGD closest match:CAL0000201231ERO1ER oxidoreductin

Protein alignments

%idAln lengthE-value
MCA_02736_167.899%5950.0MCA_02736_1
A0A0J9XH45_GEOCN56.696%5750.0Similar to Saccharomyces cerevisiae YML130C ERO1 Thiol oxidase required for oxidative protein folding in the endoplasmic reticulum OS=Geotrichum candidum GN=BN980_GECA16s02441g PE=4 SV=1
UniRef50_A0A0J9XH4556.696%5750.0Similar to Saccharomyces cerevisiae YML130C ERO1 Thiol oxidase required for oxidative protein folding in the endoplasmic reticulum n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XH45_GEOCN
A0A060T7A3_BLAAD44.923%5811.43e-161ARAD1C26840p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C26840g PE=4 SV=1
A0A161HGR4_9ASCO42.905%5923.59e-152Ero1p OS=Sugiyamaella lignohabitans GN=ERO1 PE=4 SV=1
A0A1E3PQ35_9ASCO44.939%4945.72e-146Endoplasmic oxidoreductin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81984 PE=4 SV=1
Q6C9P0_YARLI42.679%5607.55e-140YALI0D09603p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D09603g PE=4 SV=1
A0A1E4TM22_9ASCO41.621%5432.06e-128Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30844 PE=4 SV=1
ERO1_YEAST32.389%5651.50e-96Endoplasmic oxidoreductin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERO1 PE=1 SV=1
A0A1D8PER8_CANAL35.849%4778.05e-77ER oxidoreductin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERO1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0182

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF110019 (ERO1-like)
  2. mobidb-lite (disord...)

Protein sequence

>MIA_04582_1
MLISYSSLIAAVAFVVSASASTPLADSPDSSQSLARTLLNPGFCAVPNGSINDACGATYDAVEHTNHRVRPILQNLVKTD
FFRFYYLDLYGDSCPLGNDGGTCGNRACAVDTVDDEKDLPVVWRASYLGQLVKDTVASESQIGGLVDAEGDKNSKDAIEL
SCVTNADDLLASGGRLGRQARDAWDKECKGKNYCVPEDDRTGPNGVYVSLLDNPERYTGYSGPHAHMMWRSVYQQNCFGY
KGEEFSSEFDENLPSSAEVEPPAPEGGECIEQRLFYRLISGMHASVSTHLCYSYLNKQTGEWGPDLSCFLSRVGNFPERL
SNIYFNYALVSRAVSKLYNYIDDLQFCPQAQAYDQATRRQILLLTRSASTSPNTFNETTIFSTPEAKLLKEEFRQRFHKV
SALMDCVGCDRCRLWGKLQAAGYGTALKIVFELSEKEDELSRKLIASLRRSELVSLINTFDRLSKSIEAVEYFREQTRVD
LEASGVSLDDLVATTKQSEVPTKKDTVYNEDDDEEESEDEDEDEEQEPQPYSIWNDPEWDLWKEAFIFLWRSYIDFPKNL
YNIMLLNAHYYWDAMIGRNEADAKDRVGRRGHLESIRVDL

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0003756 protein disulfide isomerase activity
GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor

Cellular Component

GO:0005783 endoplasmic reticulum