Protein
MIA_04582_1
Length
600 amino acids
Browser: contig06:428467-430270+
Protein function
| EGGNOG: | 0PG36 | ERO1 | Essential oxidoreductase that oxidizes proteins in the endoplasmic reticulum to produce disulfide bonds. Acts by oxidizing directly pdi1 isomerase through a direct disulfide exchange. Does not act as a direct oxidant of folding substrate, but relies on pdi1 to transfer oxidizing equivalent. Does not oxidize all pdi related proteins, suggesting that it can discriminate between pdi1 and related proteins. Its reoxidation probably involves electron transfer to molecular oxygen via FAD. Acts independently of glutathione. May be responsible for a significant proportion of reactive oxygen species (ROS) in the cell, thereby being a source of oxidative stress |
|---|---|---|---|
| SGD closest match: | S000004599 | ERO1 | Endoplasmic oxidoreductin-1 |
| CGD closest match: | CAL0000201231 | ERO1 | ER oxidoreductin |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02736_1 | 67.899% | 595 | 0.0 | MCA_02736_1 |
| A0A0J9XH45_GEOCN | 56.696% | 575 | 0.0 | Similar to Saccharomyces cerevisiae YML130C ERO1 Thiol oxidase required for oxidative protein folding in the endoplasmic reticulum OS=Geotrichum candidum GN=BN980_GECA16s02441g PE=4 SV=1 |
| UniRef50_A0A0J9XH45 | 56.696% | 575 | 0.0 | Similar to Saccharomyces cerevisiae YML130C ERO1 Thiol oxidase required for oxidative protein folding in the endoplasmic reticulum n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XH45_GEOCN |
| A0A060T7A3_BLAAD | 44.923% | 581 | 1.43e-161 | ARAD1C26840p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C26840g PE=4 SV=1 |
| A0A161HGR4_9ASCO | 42.905% | 592 | 3.59e-152 | Ero1p OS=Sugiyamaella lignohabitans GN=ERO1 PE=4 SV=1 |
| A0A1E3PQ35_9ASCO | 44.939% | 494 | 5.72e-146 | Endoplasmic oxidoreductin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81984 PE=4 SV=1 |
| Q6C9P0_YARLI | 42.679% | 560 | 7.55e-140 | YALI0D09603p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D09603g PE=4 SV=1 |
| A0A1E4TM22_9ASCO | 41.621% | 543 | 2.06e-128 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30844 PE=4 SV=1 |
| ERO1_YEAST | 32.389% | 565 | 1.50e-96 | Endoplasmic oxidoreductin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERO1 PE=1 SV=1 |
| A0A1D8PER8_CANAL | 35.849% | 477 | 8.05e-77 | ER oxidoreductin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERO1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0182
Protein family membership
- Endoplasmic reticulum oxidoreductin 1 (IPR007266)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04137 (ERO1)
-
PIRSF017205 (ERO)
-
no IPR
Unintegrated signatures
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SSF110019 (ERO1-like)
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_04582_1 MLISYSSLIAAVAFVVSASASTPLADSPDSSQSLARTLLNPGFCAVPNGSINDACGATYDAVEHTNHRVRPILQNLVKTD FFRFYYLDLYGDSCPLGNDGGTCGNRACAVDTVDDEKDLPVVWRASYLGQLVKDTVASESQIGGLVDAEGDKNSKDAIEL SCVTNADDLLASGGRLGRQARDAWDKECKGKNYCVPEDDRTGPNGVYVSLLDNPERYTGYSGPHAHMMWRSVYQQNCFGY KGEEFSSEFDENLPSSAEVEPPAPEGGECIEQRLFYRLISGMHASVSTHLCYSYLNKQTGEWGPDLSCFLSRVGNFPERL SNIYFNYALVSRAVSKLYNYIDDLQFCPQAQAYDQATRRQILLLTRSASTSPNTFNETTIFSTPEAKLLKEEFRQRFHKV SALMDCVGCDRCRLWGKLQAAGYGTALKIVFELSEKEDELSRKLIASLRRSELVSLINTFDRLSKSIEAVEYFREQTRVD LEASGVSLDDLVATTKQSEVPTKKDTVYNEDDDEEESEDEDEDEEQEPQPYSIWNDPEWDLWKEAFIFLWRSYIDFPKNL YNIMLLNAHYYWDAMIGRNEADAKDRVGRRGHLESIRVDL
GO term prediction
Biological Process
GO:0055114 oxidation-reduction process
Molecular Function
GO:0003756 protein disulfide isomerase activity
GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
Cellular Component
GO:0005783 endoplasmic reticulum