Protein

MIA_04569_1

Length
457 amino acids

Browser: contig06:383988-385362+

Protein function

EGGNOG:0PHI2RVB1DNA helicase which participates in several chromatin remodeling complexes, including the SWR1 and the INO80 complexes. The SWR1 complex mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. The INO80 complex remodels chromatin by shifting nucleosomes and is involved in DNA repair. Also involved in pre-rRNA processing (By similarity)
SGD closest match:S000002598RVB1RuvB-like protein 1
CGD closest match:CAL0000181596RVB1RuvB-like helicase 1

Protein alignments

%idAln lengthE-value
MCA_03973_185.777%4570.0MCA_03973_1
A0A0J9XBY6_GEOCN81.798%4560.0RuvB-like helicase OS=Geotrichum candidum GN=BN980_GECA08s03332g PE=3 SV=1
A0A161HFZ3_9ASCO81.360%4560.0RuvB-like helicase OS=Sugiyamaella lignohabitans GN=RVB1 PE=3 SV=1
A0A1E3PHV6_9ASCO79.212%4570.0RuvB-like helicase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46721 PE=3 SV=1
RUVB1_YEAST74.730%4630.0RuvB-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVB1 PE=1 SV=1
RUVB1_CANAL74.891%4580.0RuvB-like helicase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVB1 PE=3 SV=1
UniRef50_C4Y38574.836%4570.0RuvB-like helicase n=17 Tax=Eukaryota TaxID=2759 RepID=C4Y385_CLAL4
A0A060TBS5_BLAAD72.429%4570.0RuvB-like helicase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B10912g PE=3 SV=1
RUVB1_YARLI73.933%4450.0RuvB-like helicase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RVB1 PE=3 SV=1
A0A1E4TMM8_9ASCO72.967%4550.0RuvB-like helicase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_95346 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0547

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 457

Detailed signature matches

  1. Domain IPR010339
    TIP49, C-terminal
    1. PF06068 (TIP49)
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR003593
    AAA+ ATPase domain
    1. SM00382 (AAA_5)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.8.60
  2. G3DSA:3.40.50...
  3. cd00009 (AAA)
  4. mobidb-lite (disord...)

Residue annotation

  1. Walker A motif cd0...
  2. ATP binding site c...

Protein sequence

>MIA_04569_1
MVQISEVKTTTARDKRTSSHTHIKGLGLDDRGIAKPVDGGFVGQDAAREACGVIVDMIKAKKLSGKAVLVVGGPGTGKTA
LALAMSQELGPRVPFCPIVGSELYSAEVKKTEALMENFRRAIGLRIKETKEVYEGEVTELTPEEAENPLGGYGKTITHVV
IGLKSAKGTRRLRLEPSIYESIQKERVAVGDVIYLEANTGAVKRVGRSDAYATEFDLEAEEYVPLPKGDVHKKKEIVQDV
TLHDLDAANARPQGGQDIMSMMGQLMKPKKTEITDKLRSEINKVVQKYIDQGVAELVPGVLFIDEVHMLDIEMFTYLNRA
LETTISPVVVLATNRGKALIRGTEDIVAPHGIPPDFIDRLLIVRTLKYTQDEVRTIVEKRSVLEETPATSAALDELARIG
HEVSLRYTLQLLAPARIVAEANGRTEIDVADVAECQDMFLDAKRSTKVLQASEKYLN

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003678 DNA helicase activity
GO:0005524 ATP binding

Cellular Component

None predicted.