Protein

MIA_04564_1

Length
171 amino acids


Browser: contig06:377969-378485-

Protein function

EGGNOG:0PKYKMitochondrial inner membrane protease subunit 1
SGD closest match:S000004758IMP1Mitochondrial inner membrane protease subunit 1
CGD closest match:CAL0000180500IMP1Mitochondrial inner membrane protease subunit 1

Protein alignments

%idAln lengthE-value
MCA_05344_164.045%1784.18e-82MCA_05344_1
A0A0J9XBP5_GEOCN63.975%1616.65e-76Mitochondrial inner membrane protease subunit 2 OS=Geotrichum candidum GN=BN980_GECA08s03024g PE=3 SV=1
A0A1E3PKE0_9ASCO55.882%1703.91e-66LexA/Signal peptidase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_65739 PE=4 SV=1
A0A060T5M9_BLAAD57.419%1553.29e-61ARAD1B13046p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B13046g PE=4 SV=1
IMP1_YEAST50.568%1765.76e-60Mitochondrial inner membrane protease subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP1 PE=1 SV=3
UniRef50_P2862750.568%1761.38e-56Mitochondrial inner membrane protease subunit 1 n=43 Tax=Saccharomycetales TaxID=4892 RepID=IMP1_YEAST
Q5AHZ1_CANAL49.171%1813.92e-58Mitochondrial inner membrane protease subunit 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IMP1 PE=3 SV=1
Q6C066_YARLI52.439%1644.90e-57YALI0F27423p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F27423g PE=4 SV=1
A0A1E4TJU4_9ASCO43.796%1375.00e-34Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_11734 PE=4 SV=1
A0A161HJT0_9ASCO33.333%1447.25e-11Imp2p OS=Sugiyamaella lignohabitans GN=IMP2 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8326
Predicted cleavage: 19

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 171

Detailed signature matches

    1. PR00727 (LEADERPTASE)
    1. SSF51306 (LexA/Sign...)
    2. PF00717 (Peptidase_S24)
    1. PS00501 (SPASE_I_1)
    1. PS00760 (SPASE_I_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd06530 (S26_SPase_I)

Residue annotation

  1. Catalytic site cd0...

Protein sequence

>MIA_04564_1
MSFLATSRRSLSWALRIGCAVHVIHTFFYEISETQGESMLPTLNYSGDFVHTNKLCARGRGCRVGDMVVALKPTDPAQRV
CKRISGMPGDVIAVDPSVDLRDAGRPPHKEPAYIKVPEGHCWVTGDNLSRSLDSRSYGVLPLGLVKGKIVAVNTRDGAFQ
WLGNTLKPVEE

GO term prediction

Biological Process

GO:0006508 proteolysis

Molecular Function

GO:0008236 serine-type peptidase activity

Cellular Component

GO:0016020 membrane
GO:0016021 integral component of membrane