Protein

MIA_04541_1

Length
99 amino acids

Browser: contig06:301897-302602+

Protein function

EGGNOG:0PPTDMitochondrial F1F0 ATP synthase subunit F
SGD closest match:S000002785ATP17ATP synthase subunit f, mitochondrial
CGD closest match:CAL0000183902ATP17F1F0 ATP synthase subunit f

Protein alignments

%idAln lengthE-value
MCA_02877_190.426%944.45e-54MCA_02877_1
A0A0J9X9B2_GEOCN76.768%991.62e-53Similar to Saccharomyces cerevisiae YDR377W ATP17 Subunit f of the F0 sector of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA05s00967g PE=4 SV=1
A0A060T291_BLAAD57.843%1022.37e-36ARAD1A06380p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A06380g PE=4 SV=1
UniRef50_M3HFB956.436%1011.54e-29ATP synthase f chain, mitochondrial, putative (Fragment) n=1 Tax=Candida maltosa (strain Xu316) TaxID=1245528 RepID=M3HFB9_CANMX
Q6C9E6_YARLI58.763%972.83e-33YALI0D11814p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D11814g PE=4 SV=1
A0A1E4TC53_9ASCO52.577%976.59e-32Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32632 PE=4 SV=1
ATPK_YEAST57.447%943.98e-31ATP synthase subunit f, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP17 PE=1 SV=1
A0A1D8PRM5_CANAL54.455%1017.57e-30F1F0 ATP synthase subunit f OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP17 PE=4 SV=1
A0A1E3PD52_9ASCO47.423%978.20e-24Putative ATP synthase f chain mitochondrial (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_14579 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2599
Predicted cleavage: 46

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR019727
    ATP synthase, F0 complex, subunit F, mitochondria, fungi
    1. PF10791 (F1F0-ATPsyn_F)

Protein sequence

>MIA_04541_1
MSQVFKRGLSTLIPPKIASSANIGAAPNAKRMVNVVNFYKALPRGEAPAPQKASGIIGWYKAKYFDKGSSAPLLHLIIAG
FLFGYANDYHFHLSHEHEH

GO term prediction

Biological Process

GO:0015986 ATP synthesis coupled proton transport

Molecular Function

None predicted.

Cellular Component

GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)