Protein

MIA_04472_1

Length
355 amino acids

Browser: contig06:126113-127181+

Protein function

EGGNOG:0PG72PGUG_02598ATP binding protein
SGD closest match:S000005788GPN2GPN-loop GTPase 2
CGD closest match:CAL0000193443orf19.3169Putative GTPase

Protein alignments

%idAln lengthE-value
MCA_05552_186.061%3300.0MCA_05552_1
A0A0J9XEL2_GEOCN79.233%3130.0Similar to Saccharomyces cerevisiae YOR262W GPN2 Putative GTPase with a role in biogenesis of RNA pol II and polIII OS=Geotrichum candidum GN=BN980_GECA10s03574g PE=4 SV=1
A0A167F9Y4_9ASCO78.305%2959.72e-178Gpn2p OS=Sugiyamaella lignohabitans GN=GPN2 PE=4 SV=1
Q6C8G4_YARLI72.644%3295.32e-165YALI0D19888p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D19888g PE=4 SV=1
A0A1E3PPG6_9ASCO73.810%2946.86e-161Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_21639 PE=4 SV=1
A0A1D8PNA7_CANAL65.782%3394.32e-150Putative GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3169 PE=4 SV=1
GPN2_YEAST63.582%3352.21e-149GPN-loop GTPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPN2 PE=1 SV=1
UniRef50_Q0872663.582%3355.28e-146GPN-loop GTPase 2 n=78 Tax=Saccharomycetales TaxID=4892 RepID=GPN2_YEAST
A0A060T9Z2_BLAAD70.169%2951.17e-148ARAD1B03608p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B03608g PE=4 SV=1
A0A1E4TLQ8_9ASCO58.359%3291.78e-131Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_89122 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3709
Predicted cleavage: 33

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 355

Detailed signature matches

  1. Family IPR004130
    GPN-loop GTPase
    1. PF03029 (ATP_bind_1)
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.50...
  3. cd00882 (Ras_like_G...)

Residue annotation

  1. G1 box cd00882
  2. GTP/Mg2+ binding s...
  3. G2 box cd00882
  4. Switch I region cd...
  5. G3 box cd00882
  6. Switch II region c...
  7. G4 box cd00882

Protein sequence

>MIA_04472_1
MPFGQLVIGPPGSGKSTYCNGMQQFLSAIGRKTSVINLDPANDRVSYPCALDIRDFTRLEDIMSELNLGPNGGIMYALEE
VENSLDDFVNMIESLGKQDYLIFDCPGQVELFTHHSALQRIFKKLEKLDYRLAVIHLVDSYYITSPSQYISILLLALRSM
LQLDLPHVNVLSKIDLLKNYGELPMNLDYYTEVQDLSYMFPHIEAEQKTVLGKRYAKLTEAIAEMVEDFGLVSFEVLAVE
DKKSMIHLLTVIDKATGYMFGSTEIGGDTVWTEATRQGGYLGIVQDIQERWIDHKEEYDEAEEKEREELFKKAKEESRPL
TEEEEWDLALKQWEKGETKKKIKLKNNRMYIPVNK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.