Protein

MIA_04471_1

Length
346 amino acids


Browser: contig06:124543-125584-

Protein function

EGGNOG:0PHXERPN8Proteasome regulatory subunit
SGD closest match:S000005787RPN826S proteasome regulatory subunit RPN8
CGD closest match:CAL0000190180RPN8Proteasome regulatory particle lid subunit

Protein alignments

%idAln lengthE-value
MCA_05553_179.341%3341.85e-176MCA_05553_1
A0A0J9X5G3_GEOCN76.161%3232.20e-169Similar to Saccharomyces cerevisiae YOR261C RPN8 Essential, non-ATPase regulatory subunit of the 26S proteasome OS=Geotrichum candidum GN=BN980_GECA03s02012g PE=4 SV=1
A0A1E3PP37_9ASCO68.639%3381.18e-166Putative 26S proteasome regulatory particle subunit Rpn8 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81757 PE=4 SV=1
A0A060TAV0_BLAAD77.778%2971.09e-162ARAD1B03630p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B03630g PE=4 SV=1
A0A161HGS9_9ASCO76.610%2953.14e-159Proteasome regulatory particle lid subunit RPN8 OS=Sugiyamaella lignohabitans GN=RPN8 PE=4 SV=1
UniRef50_Q8WZY468.060%3359.87e-15326S proteasome regulatory subunit rpn-8 n=426 Tax=Eukaryota TaxID=2759 RepID=RPN8_NEUCR
Q6C8G3_YARLI72.203%2954.61e-150YALI0D19910p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D19910g PE=4 SV=1
A0A1D8PNA8_CANAL66.443%2983.62e-140Proteasome regulatory particle lid subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPN8 PE=4 SV=1
RPN8_YEAST62.617%3212.84e-13926S proteasome regulatory subunit RPN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN8 PE=1 SV=3
A0A1E4TJT8_9ASCO63.448%2901.66e-122Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_573 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0199

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 346

Detailed signature matches

    1. cd08062 (MPN_RPN7_8)
    1. SM00232 (pad1_6)
    2. PF01398 (JAB)
    1. PF13012 (MitMem_reg)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)
  2. mobidb-lite (disord...)

Protein sequence

>MIA_04471_1
MPAELTQLSNKTVTVAPLVLLSVVDHYNRSVKDTKKRVLGVLLGDVRGSTIKVTNSFAVPFEEDDKKSSVWFLDHNYVEA
MSDMFKKVNAKEKLIGWYHSGPKLRGSDLEINELFKKYTPNPLLLVVDVQPKTVGIPTDAYIAIEEIKDDGTSAERTFVH
IPSSIEAEEAEEIGVEHLLRDIRDAAAGSLSLRITNQLQSLQGLHHRIRDIAVYLQRVLDGELPVNHVILGKLQDVFNLL
PNLSTTTSVAQADGSSAGVESSNHGRAFTVKTNDDMMIVYLSSLVRAIIAFHNLIENKIENRKSSAIGDKKSTSKADSTE
ADTPKTEGADGESEKSSEDKTEKSSK

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

GO:0005838 proteasome regulatory particle