Protein
MIA_04332_1
Length
95 amino acids
Browser: contig05:1432951-1433383-
Protein function
EGGNOG: | 0PQWD | FG09498.1 | NA |
---|---|---|---|
SGD closest match: | S000002101 | SFT1 | Protein transport protein SFT1 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_02963_1 | 69.149% | 94 | 4.30e-39 | MCA_02963_1 |
A0A0J9X505_GEOCN | 65.591% | 93 | 8.89e-36 | Similar to Saccharomyces cerevisiae YKL006C-A SFT1 Intra-Golgi v-SNARE, required for transport of proteins between an early and a later Golgi compartment OS=Geotrichum candidum GN=BN980_GECA02s07171g PE=4 SV=1 |
A0A1E3PJN1_9ASCO | 53.684% | 95 | 5.78e-29 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50906 PE=4 SV=1 |
Q6C6Y5_YARLI | 56.757% | 74 | 4.53e-28 | YALI0E05269p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E05269g PE=4 SV=1 |
UniRef50_Q6C6Y5 | 56.757% | 74 | 1.05e-24 | YALI0E05269p n=5 Tax=Saccharomycetales TaxID=4892 RepID=Q6C6Y5_YARLI |
A0A060T376_BLAAD | 52.747% | 91 | 2.08e-25 | ARAD1C35090p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C35090g PE=4 SV=1 |
A0A1E4THY7_9ASCO | 45.055% | 91 | 1.90e-20 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32023 PE=4 SV=1 |
SFT1_YEAST | 40.000% | 90 | 5.37e-14 | Protein transport protein SFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFT1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0018
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
cd15853 (SNARE_Bet1)
Residue annotation
-
heterotetramer int...
-
zero layer cd15853
Protein sequence
>MIA_04332_1 MSSSYQQEEQNDHRLNELHKKITQLRSVTNDIYDQASDHSFIDSATESINTLFTGVRASSGRLARSVTAGHPVFKTVGLA LAVVLGLYFLYRVFA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.