Protein

MIA_04266_1

Length
247 amino acids

Browser: contig05:1237405-1238316-

Protein function

EGGNOG:0PH7XSCL1The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000002979SCL1Proteasome subunit alpha type-1
CGD closest match:CAL0000198208SCL1Proteasome endopeptidase complex

Protein alignments

%idAln lengthE-value
MCA_06519_183.40%2477e-151MCA_06519_1
A0A060TBI5_BLAAD80.97%2472e-149Proteasome endopeptidase complex OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B08008g PE=3 SV=1
A0A0J9X7E6_GEOCN81.78%2473e-143Proteasome endopeptidase complex OS=Geotrichum candidum GN=BN980_GECA04s04586g PE=3 SV=1
UniRef50_K1WYK572.83%2544e-132Proteasome subunit alpha type n=30 Tax=leotiomyceta TaxID=716546 RepID=K1WYK5_MARBU
Q6CCW2_YARLI76.11%2474e-132Proteasome endopeptidase complex OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C06039g PE=3 SV=1
A0A1E3PKZ8_9ASCO76.52%2474e-127Proteasome endopeptidase complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46534 PE=3 SV=1
A0A1D8PJ20_CANAL69.20%2501e-126Proteasome endopeptidase complex OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCL1 PE=3 SV=1
A0A1E4TJP8_9ASCO67.21%2471e-123Proteasome endopeptidase complex OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_80966 PE=3 SV=1
PSA1_YEAST64.34%2443e-105Proteasome subunit alpha type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCL1 PE=1 SV=1
A0A167DVY1_9ASCO82.27%1414e-77Proteasome endopeptidase complex OS=Sugiyamaella lignohabitans GN=SCL1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0269

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 247

Detailed signature matches

  1. Family IPR001353
    Proteasome, subunit alpha/beta
    1. PF00227 (Proteasome)
  2. Family IPR023332
    Proteasome alpha-type subunit
    1. PS51475 (PROTEASOME...)
  3. Family IPR034642
    Proteasome subunit alpha6
    1. cd03754 (proteasome...)
  4. Domain IPR029055
    Nucleophile aminohydrolases, N-terminal
    1. G3DSA:3.60.20.10
    2. SSF56235 (N-termina...)
  5. Domain IPR000426
    Proteasome alpha-subunit, N-terminal domain
    1. PS00388 (PROTEASOME...)
    2. PF10584 (Proteasome...)
    3. SM00948 (Proteasome...)

Residue annotation

  1. alpha subunit inte...
  2. active site cd03754

Protein sequence

>MIA_04266_1
MSGSAGYDRHITIFSPEGRLYQVEYAFKAINSANITSLGVCGKDCAVIISQKKVPDKLLDPASVSYLFQISPTIGAVYTG
SIADARASVQRARSEAAEFAYKNGYPMPCDALAKRLANISQIYTQRAYMRPLGIAVTLISVDDEHGPMLYKCDPAGYYVG
YKATATGPKQQEVMNAFEKKLKKKDHAAGDWKQVTELAISTLSSVLSVDFRKNDLEIGVVGIDGNPNFRILTPDEIDERL
VSLAEQD

GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex