Protein
MIA_04193_1
Length
323 amino acids
Browser: contig05:1028853-1029891-
Protein function
| EGGNOG: | 0PMW8 | GPI11 | biosynthesis protein |
|---|---|---|---|
| SGD closest match: | S000002710 | GPI11 | Glycosylphosphatidylinositol anchor biosynthesis protein 11 |
| CGD closest match: | CAL0000185478 | GPI11 | Glycosylphosphatidylinositol anchor biosynthesis protein 11 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02936_1 | 63.404% | 235 | 2.38e-88 | MCA_02936_1 |
| A0A0J9XI16_GEOCN | 57.209% | 215 | 1.49e-77 | Similar to Saccharomyces cerevisiae YDR302W GPI11 ER membrane protein involved in a late step of glycosylphosphatidylinositol (GPI) anchor assembly OS=Geotrichum candidum GN=BN980_GECA18s01825g PE=4 SV=1 |
| UniRef50_A0A0J9XI16 | 57.209% | 215 | 3.06e-74 | Similar to Saccharomyces cerevisiae YDR302W GPI11 ER membrane protein involved in a late step of glycosylphosphatidylinositol (GPI) anchor assembly n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XI16_GEOCN |
| A0A161HID8_9ASCO | 52.558% | 215 | 5.23e-71 | Gpi11p OS=Sugiyamaella lignohabitans GN=GPI11 PE=4 SV=1 |
| A0A1E3PCW4_9ASCO | 50.000% | 228 | 2.63e-65 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84411 PE=4 SV=1 |
| A0A060T8U2_BLAAD | 47.926% | 217 | 1.01e-61 | ARAD1D10252p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D10252g PE=4 SV=1 |
| GPI11_YARLI | 43.062% | 209 | 1.75e-53 | Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPI11 PE=3 SV=1 |
| A0A1E4TDD0_9ASCO | 45.045% | 111 | 5.34e-24 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_143062 PE=4 SV=1 |
| GPI11_CANAL | 38.679% | 106 | 3.42e-16 | Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI11 PE=3 SV=1 |
| GPI11_YEAST | 39.252% | 107 | 5.62e-15 | Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI11 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2760
Predicted cleavage: 188
Protein family membership
- GPI biosynthesis protein Pig-F (IPR009580)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_04193_1 MPQRKSARQQTTSSPASLTSSHSPSPDPASTVPANSASSAASAQRAAASATPSPDTKPLSRAHSRAHNHHHHGKQHHNHH AATATNQKFHQSSAYALILLALVYLAFFRGGLAADPAATMLQAVPIVVILQVWYCASGMLDGSSNNIPTSTSAAVAAAAA AAAAAAAASSGTSSSTSTSSTTLSKRNDPNKTPVKSALLAAVLAIMMSVLVFGLLILFGAPASTMIPSTFLCAVHISLLS VLPLVYIYNLDAQTWKDIISVRLPLNGVYGASVGTWVGAWLGAIPIPLDWDRPWQQWPITILVGAYIGTALGTLIGATYR KLK
GO term prediction
Biological Process
GO:0006506 GPI anchor biosynthetic process
Molecular Function
None predicted.
Cellular Component
GO:0005789 endoplasmic reticulum membrane
GO:0016021 integral component of membrane