Protein
MIA_04109_1
Length
130 amino acids
Browser: contig05:773677-774141+
Protein function
EGGNOG: | 0PQ6Q | PAM16 | Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18 TIM14. May act by positioning PAM18 TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation |
---|---|---|---|
SGD closest match: | S000003640 | PAM16 | Mitochondrial import inner membrane translocase subunit TIM16 |
CGD closest match: | CAL0000176330 | PAM16 | Mitochondrial import inner membrane translocase subunit TIM16 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XEX7_GEOCN | 71.70% | 106 | 9e-49 | Similar to Saccharomyces cerevisiae YJL104W PAM16 Constituent of the import motor (PAM complex) component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) OS=Geotrichum candidum GN=BN980_GECA13s00406g PE=4 SV=1 |
MCA_00115_2 | 71.56% | 109 | 1e-45 | MCA_00115_2 |
A0A060T767_BLAAD | 63.30% | 109 | 6e-44 | ARAD1B20966p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B20966g PE=4 SV=1 |
TIM16_YEAST | 58.49% | 106 | 2e-38 | Mitochondrial import inner membrane translocase subunit TIM16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAM16 PE=1 SV=1 |
UniRef50_P42949 | 58.49% | 106 | 4e-35 | Mitochondrial import inner membrane translocase subunit TIM16 n=53 Tax=Saccharomycetales TaxID=4892 RepID=TIM16_YEAST |
A0A161HMN3_9ASCO | 66.02% | 103 | 2e-37 | Pam16p OS=Sugiyamaella lignohabitans GN=PAM16 PE=4 SV=1 |
A0A1E3PG07_9ASCO | 58.49% | 106 | 5e-35 | Protein transporter OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83846 PE=4 SV=1 |
TIM16_YARLI | 44.07% | 118 | 1e-27 | Mitochondrial import inner membrane translocase subunit TIM16 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAM16 PE=3 SV=1 |
TIM16_CANAL | 56.57% | 99 | 3e-25 | Mitochondrial import inner membrane translocase subunit TIM16 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAM16 PE=3 SV=1 |
A0A1E4TH31_9ASCO | 48.00% | 100 | 2e-24 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2773 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0955
Predicted cleavage: 30
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
PF03656 (Pam16)
-
mobidb-lite (disord...)
Protein sequence
>MIA_04109_1 MVFIITGTQVFGKAFAEAYHQASNASIRAGASAEARKRTGGISYDEACKILDVDSSHLPSYDKLQNKYNYLFDVNSKERG GSFYLQSKVYRSMERIKYELEKRGEKIPTNEGPAAGAEAKAGDSSGAAKS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.