Protein

MIA_04047_1

Length
429 amino acids

Browser: contig05:602470-603899+

Protein function

EGGNOG:0PFSBTUF1This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis (By similarity)
SGD closest match:S000005713TUF1Elongation factor Tu, mitochondrial
CGD closest match:CAL0000198818TUF1Elongation factor Tu

Protein alignments

%idAln lengthE-value
MCA_00043_188.684%4330.0MCA_00043_1
A0A0J9XC87_GEOCN87.822%4270.0Elongation factor Tu OS=Geotrichum candidum GN=BN980_GECA08s05015g PE=3 SV=1
A0A060TCE7_BLAAD80.769%4160.0Elongation factor Tu OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B15994g PE=3 SV=1
A0A167E7N5_9ASCO81.687%4150.0Elongation factor Tu OS=Sugiyamaella lignohabitans GN=TUF1 PE=3 SV=1
A0A1E3PIK8_9ASCO77.305%4230.0Elongation factor Tu OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46970 PE=3 SV=1
EFTU_YEAST79.849%3970.0Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1
UniRef50_P0299279.849%3970.0Elongation factor Tu, mitochondrial n=5157 Tax=root TaxID=1 RepID=EFTU_YEAST
Q6C0I5_YARLI71.127%4260.0Elongation factor Tu OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F24387g PE=3 SV=1
Q5ABC3_CANAL75.439%3990.0Elongation factor Tu OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUF1 PE=3 SV=1
A0A1E4TAF6_9ASCO69.930%4290.0Elongation factor Tu OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_128467 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7729
Predicted cleavage: 39

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 429

Detailed signature matches

  1. Family IPR004541
    Translation elongation factor EFTu/EF1A, bacterial/organelle
    1. MF_00118_B (EF_Tu_B)
    2. TIGR00485
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
  4. Domain IPR000795
    Transcription factor, GTP-binding domain
    1. PS51722 (G_TR_2)
    2. PF00009 (GTP_EFTU)
    3. PR00315 (ELONGATNFCT)
  5. Domain IPR009000
    Translation protein, beta-barrel domain
    1. SSF50447 (Translati...)
  6. Domain IPR004161
    Translation elongation factor EFTu-like, domain 2
    1. PF03144 (GTP_EFTU_D2)
  7. Domain IPR033720
    Elongation factor Tu, domain 2
    1. cd03697 (EFTU_II)
  8. Domain IPR009001
    Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal
    1. SSF50465 (EF-Tu/eEF...)
  9. Domain IPR004160
    Translation elongation factor EFTu/EF1A, C-terminal
    1. PF03143 (GTP_EFTU_D3)
  10. SITE IPR031157
    Tr-type G domain, conserved site
    1. PS00301 (G_TR_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:2.40.30.10
  2. G3DSA:3.40.50...
  3. cd01884 (EF_Tu)
  4. cd03707 (EFTU_III)

Residue annotation

  1. G1 box cd01884
  2. GEF interaction si...
  3. GTP/Mg2+ binding s...
  4. Switch I region cd...
  5. G2 box cd01884
  6. G3 box cd01884
  7. Switch II region c...
  8. G4 box cd01884
  9. G5 box cd01884
  10. tRNA binding site ...
  11. 16S rRNA binding s...
  12. antibiotic binding...
  13. heterodimer interf...
  14. tRNA binding site ...

Protein sequence

>MIA_04047_1
MAAARVLRPLNLLRFAAPFRAVASPIAQKVRFASFERTKPHLNIGTIGHVDHGKTTLTAAITKVLADKGGAQFLDYASID
KAPEERARGITITSAHVEYETDKRHYAHVDCPGHADYIKNMISGAARMDGAIIVVAASDGQMPQTREHLLLARQVGIEHI
VVFVNKVDTVDDPEMLELVEMEMRELLTSYGFDGDNTPVIMGSALCALEDREPKIGRDSILKLLDAIDEYIPTPVRDMDQ
PFLMPLEGVFSIPGRGTVATGRVYRGTLKRGEEVEIVGFNDTPIKTTVTGIEMFKKELDQAQAGDNAGILLRGVKREDLK
RGMVICKPGTIKPHTKFLASIYVLSKEEGGRHSGFGVNYRPQLFIGSADVTTVLTFPEGVDESTQVMPGDNTEMVCELVH
PTAVEQGQRFNIREGGRTVGTGLITRIIA

GO term prediction

Biological Process

GO:0006414 translational elongation

Molecular Function

GO:0003746 translation elongation factor activity
GO:0003924 GTPase activity
GO:0005525 GTP binding

Cellular Component

GO:0005622 intracellular