Protein
MIA_04027_1
Length
136 amino acids
Browser: contig05:550829-551319+
Protein function
| EGGNOG: | 0PPJS | NUFM | ETC complex I subunit conserved region |
|---|---|---|---|
| CGD closest match: | CAL0000198704 | MCI4 | Mci4p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X5R7_GEOCN | 80.769% | 130 | 6.00e-77 | NUFM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA03s07314g PE=4 SV=1 |
| MCA_02252_1 | 80.303% | 132 | 2.38e-74 | MCA_02252_1 |
| Q6C4W9_YARLI | 66.906% | 139 | 2.45e-65 | YALI0E23089p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E23089g PE=4 SV=2 |
| A0A060T882_BLAAD | 67.164% | 134 | 7.67e-61 | ARAD1C27412p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C27412g PE=4 SV=1 |
| UniRef50_E1UWB0 | 63.359% | 131 | 3.02e-55 | NUFM (B13) subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I) n=4 Tax=Komagataella TaxID=460517 RepID=E1UWB0_PICPA |
| Q5A995_CANAL | 54.412% | 136 | 3.27e-49 | Mci4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCI4 PE=4 SV=1 |
| A0A167EGH2_9ASCO | 64.103% | 117 | 1.03e-48 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_5010 PE=4 SV=1 |
| A0A1E4TJ72_9ASCO | 48.855% | 131 | 9.86e-42 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_365 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7774
Protein family membership
- ETC complex I subunit (IPR006806)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04716 (ETC_C1_NDUFA5)
-
Protein sequence
>MIA_04027_1 MRYSRFLRNVQEVLIKTESGRPTGITGLYQHPNPRPALIAVYNATLKELEKSFPKESVYRQSVENITAARKEIVENYEVT EVIENKIGSGLIEEILIQAGEEYELVKKMAEWKPWEELAEKPLPDQWEYFSSMNKD
GO term prediction
Biological Process
GO:0022904 respiratory electron transport chain
Molecular Function
GO:0016651 oxidoreductase activity, acting on NAD(P)H
Cellular Component
GO:0005743 mitochondrial inner membrane