Protein
MIA_04013_1
Length
187 amino acids
Browser: contig05:506436-507205+
Protein function
| EGGNOG: | 0PNSI | FG06337.1 | NADH-ubiquinone oxidoreductase 21.3 kDa subunit |
|---|---|---|---|
| CGD closest match: | CAL0000197916 | orf19.2954 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02211_1 | 69.832% | 179 | 3.59e-82 | MCA_02211_1 |
| A0A0J9YHJ8_GEOCN | 63.243% | 185 | 1.01e-77 | NUJM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA01s05532g PE=4 SV=1 |
| UniRef50_A0A0J9YHJ8 | 63.243% | 185 | 2.07e-74 | NUJM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9YHJ8_GEOCN |
| A0A060T9D3_BLAAD | 46.995% | 183 | 9.66e-53 | ARAD1D14542p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D14542g PE=4 SV=1 |
| A0A1E4TE38_9ASCO | 38.728% | 173 | 2.23e-37 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_99630 PE=4 SV=1 |
| Q6C674_YARLI | 41.040% | 173 | 6.97e-32 | YALI0E11891p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E11891g PE=4 SV=2 |
| A0A1D8PCU5_CANAL | 37.255% | 102 | 5.66e-10 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2954 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2874
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MIA_04013_1 MTLNDTFPTITLREYPDYTPRNTLKLTLQSAAVSAGFGLVASAIKNSLSNPKTSGFLYPKIGYHVFLYAAGGSAFTFGEA VSANLREKEDGWNTANGGALAGAVIGATFKTLPKVIGFALLTGSALGIYGWSGGIAGYGREDALKVAGDITDISEKPKQG FWEVVHRRPLSQTLEELGDLVRPFESK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.